KEGG   Mycobacterium rhodesiae: MycrhN_1693Help
Entry
MycrhN_1693       CDS       T01685                                 

Definition
ADP-ribose pyrophosphatase
Organism
mrh  Mycobacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1725693..1726412)
Genome map
AA seq 239 aa AA seqDB search
MTVTYDDGLRDQVRAQLAGHDRRALTDPTKRHAAVAVVLVDSELGEDRVDPANVDDWIDG
RLMPEEGLDGRMIDVSGGAAFLLCRRTSRLSSHPAQWALPGGRLDPGEDAVDAALRELDE
EVGVTLGHSSVLGLLDDYPTRSGYVITPVVIWGGGRLDLRPAPDEVVAVYRVGLHQLQRD
DSPRFITIAESPRPVVQIPLGNDLIHAPTGAVLLQLRWLCLEGRHDPVHELEQPVFAWK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcacctacgacgacggactccgcgaccaggtccgcgctcaactcgccgggcac
gaccgacgtgccttgaccgacccgacgaagcggcacgccgcggtcgcggtggtcctcgtc
gactccgagctcggggaagatcgggtcgacccggcgaacgtcgatgactggatcgacggc
cggctgatgccggaggagggcctcgacggtcgcatgatcgacgtctccggcggcgctgct
tttctgttgtgtcgcaggacgtcccgcctctcatcacaccccgcccagtgggcactcccc
ggcggcaggctcgaccccggcgaggatgccgtcgacgcggcgctgcgcgaactcgacgaa
gaggtgggcgtcacgctcggccattcctcagtgctcggcctgctcgacgactacccgacc
cggtcgggctacgtgatcaccccggtggtgatctggggtggcggacgactggacctgcgg
cccgcacccgacgaagtggtcgcggtctaccgggtcggactgcatcagctccagcgcgac
gattcgccgcgcttcatcaccatcgcggagagcccgcgccccgtcgtgcagataccgctg
ggcaacgacctgatccatgcgccgaccggtgcggtgctgctgcaactgcggtggctgtgc
ctggagggtcgccacgatcccgtccacgagctcgaacaacccgtgttcgcctggaagtag

DBGET integrated database retrieval system