KEGG   Mycobacterium rhodesiae: MycrhN_2032Help
Entry
MycrhN_2032       CDS       T01685                                 

Definition
ATP-dependent DNA ligase
Organism
mrh  Mycobacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2060998..2062077)
Genome map
AA seq 359 aa AA seqDB search
MELPVLPPVSPMLAKAVREIPPDASYEPKWDGFRSICFRDGDEVELGSRNERPLTRYFPE
LVAAVRAELPNRCVIDGEIVIATDRGLDFEALQQRIHPADSRVRMLAQKTPATFIVFDLL
ALDDEDFTSRPFSERRAALVEALAGSGPSIHVTPATTDLPTARRWFAEFEGAGLDGLIAK
PLTVKYQPDKRVMFKIKPERTADCVVAGYRVHKSSDEAIGSLLLGLYSGDGTLASVGVIG
AFPMAKRRELFTELQPLITTFDEHPWNWAAHMSGERTPRRNEGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGERFRHTAQFNRWRPDRDPRSCTYDQLEQPVTFSLGDIVPGLGGGSGV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcccgtgctgcctccggtgtccccgatgctggccaaggcggtgcgcgagatt
ccgccggacgcctcgtacgagcccaaatgggacgggttccgctcgatctgcttccgcgat
ggtgatgaggtcgagttgggcagtcggaatgaacgcccgctcaccaggtactttcccgag
ctcgtcgcggccgtccgcgccgaattgccgaaccggtgtgtgatcgacggtgagatcgtc
atcgcgaccgaccgggggctggacttcgaagcgctacagcagcgcatccatccggccgac
tcacgcgtgcgcatgctcgcgcaaaagacgccggcgacgttcatcgtcttcgacctgctc
gccctcgatgacgaggacttcacgtcgaggccgttcagcgagcggcgcgcggcgctggtc
gaggcgctggccgggtcgggcccgtccatccacgtcacccccgcgaccaccgacctgccg
accgcgcggcgctggttcgcggagttcgagggcgcgggtctcgacggcctgatcgccaaa
cccttgaccgtgaagtatcagccggacaagcgcgtcatgttcaagatcaagcccgaacgg
acggcggactgcgtcgttgcgggttaccgggtgcacaagtcgagcgacgaagcgatcgga
tcgctgctgctcggcctgtactcaggtgacggcacgctcgcatcggtgggtgtcatcggc
gcgttcccgatggccaagcggcgcgagctgttcaccgagttgcagccgctgataacgact
ttcgatgagcacccgtggaactgggccgctcatatgtcgggtgaacgcacgccgcgccgc
aacgagggatcccgctggaatgcgggcaaggacctctcattcgtcccgctgcgtcccgaa
cgggtcgtcgaggtccgctacgaccacatggagggtgaacggttccgccacaccgcccag
ttcaatcgctggcgacccgaccgggacccgcggtcgtgcacctacgaccaactcgaacaa
ccggtgaccttcagcctcggtgacatcgttcccggcctcggaggaggctccggcgtttag

DBGET integrated database retrieval system