KEGG   Mycobacterium rhodesiae: MycrhN_2072Help
Entry
MycrhN_2072       CDS       T01685                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mrh  Mycobacterium rhodesiae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MycrhN_2072
DNA repair and recombination proteins [BR:mrh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MycrhN_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2104855..2105466
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPEIDRLTAVLGKVRDGVTFCAVCG
NVSDEERCRICSDARRDGSVVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPEQ
LRIRELLNRIGERVDGVDIAEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgagggcccggtccaggatctgatcgacgagctcggcaagttgccgggcatcggg
ccgaagagtgcgcagcggatcgcgtttcacctgctgtccgtcgagccgccagagatcgac
cggttgaccgcggtgctcggcaaggtccgcgacggcgtcacgttctgcgcggtgtgtggc
aacgtctccgacgaagagcgatgccgaatctgttcggatgcgcgtcgagacggatcggtc
gtgtgcgtggtcgaggaaccgaaggatgtgcaggcggtcgagcgcacccgcgagtttcgc
ggcaggtatcacgtgctgggcggcgccctggatccgttgtcgggaatcggacccgagcaa
ctgcgaattcgtgagctgctgaacaggattggcgaacgcgtcgacggcgtggacatcgcc
gaggtgatcatcgcgaccgatccgaacaccgaaggcgaagcgacggcgacgtacctcgtg
cggatgctgcgcgacattccgggtctcaccgtgacgcgtatcgcctcgggactgccgatg
ggcggtgacctggagttcgccgacgaattgacgctgggccgcgcgctcgcgggccgccgc
gcgatggcctag

DBGET integrated database retrieval system