KEGG   Mycobacterium rhodesiae: MycrhN_2072Help
Entry
MycrhN_2072       CDS       T01685                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mrh  Mycobacterium rhodesiae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mrh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2104855..2105466
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPEIDRLTAVLGKVRDGVTFCAVCG
NVSDEERCRICSDARRDGSVVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPEQ
LRIRELLNRIGERVDGVDIAEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgagggcccggtccaggatctgatcgacgagctcggcaagttgccgggcatcggg
ccgaagagtgcgcagcggatcgcgtttcacctgctgtccgtcgagccgccagagatcgac
cggttgaccgcggtgctcggcaaggtccgcgacggcgtcacgttctgcgcggtgtgtggc
aacgtctccgacgaagagcgatgccgaatctgttcggatgcgcgtcgagacggatcggtc
gtgtgcgtggtcgaggaaccgaaggatgtgcaggcggtcgagcgcacccgcgagtttcgc
ggcaggtatcacgtgctgggcggcgccctggatccgttgtcgggaatcggacccgagcaa
ctgcgaattcgtgagctgctgaacaggattggcgaacgcgtcgacggcgtggacatcgcc
gaggtgatcatcgcgaccgatccgaacaccgaaggcgaagcgacggcgacgtacctcgtg
cggatgctgcgcgacattccgggtctcaccgtgacgcgtatcgcctcgggactgccgatg
ggcggtgacctggagttcgccgacgaattgacgctgggccgcgcgctcgcgggccgccgc
gcgatggcctag

DBGET integrated database retrieval system