KEGG   Mycobacterium rhodesiae: MycrhN_2107Help
Entry
MycrhN_2107       CDS       T01685                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MycrhN_2107
Enzymes [BR:mrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MycrhN_2107
Exosome [BR:mrh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MycrhN_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2140124..2141641
Genome map
AA seq 505 aa AA seqDB search
MAEFVAAIDQGTTSTRCMIFDHDGAEVGRHQLEHEQILPKAGWVEHNPVEITERTASVIQ
SALNKTNLSATDLCALGITNQRETSLVWNRKTGRPYYNAIVWQDTRTDRIASALDRDDRG
DVIRRKAGLPPATYFSGGKLQWILENIDGVRRDAENGDAIFGTADTWVLWNLTGGTRGGV
HAVDVTNASRTMLMNLETLDWDDELLSFFDIPRQMLPEIKASSLPEAFGVTRDNGPVGGE
VPITGILGDQQAAMVGQVCLDAGEAKNTYGTGNFLLLNTGEKIVRSENGLLTTVCYQFGD
AKPVYALEGSIAVTGSAVQWLRDQLGIISGASESESLARQVQDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVHMEVLKVDGGITAN
DLCMQIQADVLGVEVVKPVVAETTALGAAYAAGLAVGFWENPDDLRANWQEGKRWSPAWS
DEQRADGYAGWQKAVQRTLDWVDVE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagtttgtcgccgccatcgaccagggcaccaccagcaccaggtgcatgatcttc
gatcacgacggtgccgaggtcgggcgtcatcaactcgagcacgaacagatcctgcccaag
gccggctgggtcgagcacaaccctgtcgagatcaccgaacgcacggcatcggtcattcag
tcggcgctgaacaagaccaacctctcagccaccgacctgtgcgcgctgggcatcaccaac
cagcgcgagacgtcgctggtgtggaaccgcaaaaccggacgaccctactacaacgcgatc
gtgtggcaggacacccgaaccgaccgcatcgcctccgcacttgaccgcgacgaccgcggc
gacgtgattcggcgcaaagcgggactgccccccgcgacctacttctccggcggcaagctg
cagtggatcctggagaacatcgacggtgtgcgccgcgacgcggagaacggcgacgcgatc
ttcgggaccgcggacacgtgggtgctgtggaacctcaccggcgggacccgtggcggcgtg
cacgccgtcgacgtcaccaacgccagccgcaccatgctgatgaacctcgagacgctggac
tgggacgacgaactgttgtcgttcttcgacattccgcgacagatgctgcctgagatcaag
gcgtcgtcgctgccggaggcatttggcgtgacccgagacaacgggccggtcggcggtgag
gtaccgatcaccggcatcctcggcgaccagcaggcagcgatggtcggccaggtctgtctc
gatgcgggcgaagccaagaacacctacggcacaggcaatttcctgctgctcaacaccggc
gagaagatcgtccgctccgagaacggactgctcaccacggtctgttatcagttcggtgac
gcgaaacctgtttacgcgctggagggttcgatcgccgtcaccggctcggcggtgcagtgg
ctacgcgatcagctcggcatcatcagcggtgcgtcggagagtgagtcgctcgcgcgtcag
gtacaggacaacggcggcgtgtacttcgtccctgccttctcgggactctttgcgccgtat
tggcgttcggatgcgcgcggggcaatcgtcgggctgtcgcggttcaacacgaacgcgcat
ctggcacgcgcgacgctggaggcgatctgctaccagagccgtgacgtcgtcgacgcgatg
gaggcggattcgggcgtgcacatggaggttctcaaggtcgacggcggcatcaccgccaac
gatctgtgcatgcagatccaggctgacgtcctcggtgtcgaagtggtcaaacccgttgtc
gccgagacgaccgcgctgggtgccgcctacgccgcgggccttgccgtcggcttctgggag
aaccccgacgatctgcgggccaactggcaggagggcaagcgctggagcccggcgtggagc
gacgaacaacgcgcagacgggtatgccggatggcagaaagccgtccagcggacgctcgac
tgggtcgacgtcgagtga

DBGET integrated database retrieval system