KEGG   Mycobacterium rhodesiae: MycrhN_2146Help
Entry
MycrhN_2146       CDS       T01685                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00010  Glycolysis / Gluconeogenesis
mrh00620  Pyruvate metabolism
mrh00640  Propanoate metabolism
mrh00680  Methane metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_2146
   00620 Pyruvate metabolism
    MycrhN_2146
   00640 Propanoate metabolism
    MycrhN_2146
  Energy metabolism
   00680 Methane metabolism
    MycrhN_2146
Enzymes [BR:mrh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MycrhN_2146
Lipid biosynthesis proteins [BR:mrh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MycrhN_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEV72742
UniProt: G8RRV9
Position
complement(2172986..2174950)
Genome map
AA seq 654 aa AA seqDB search
MTGTSTKHSDVPSVYPPSEEFAAQANATEELYRDAEADRLAFWAKQAERLAWDTPFTEVL
DWSEAPFAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHWQGEPADDTRDITYAQLQTDVC
KAANALTEMGLVAGDRVAIYMPMLPEAIVSMLACARLGIMHSVVFAGFSATALAARIEDA
EAKLVITSDGQFRRGQAVSLKDAVDEACKGQDSIEHVLVVRRTGIDTPWSEGRDLWWHDT
VDPASAEHTPEAFDSEHPLFLLYTSGTTGKPKGIMHTTGGYLTQASFTHHYVFDIKPETD
VYWCTADIGWVTGHTYIVYGPLSNGATQVVYEGTPNSPDEHRHFQVIEKYGVTIYYTAPT
LVRMFMKWGREFPDAHDLSSLRLLGSVGEPINPEAWRWYRDAFGGNRTPIVDTWWQTETG
AIMISPLPGVTAAKPGSAMKPLPGISAIIVDEEGKELVPGADEAEHVTGYLVLDKPWPAM
LRGIWGDPERYKETYWSRYGKQGWYFAGDGARVDSDGSIWLLGRIDDVMNVSGHRISTTE
VESALVGHSHVAEAAVVGASDETTGQGICAFVILESHAKHRDNDEMTQELREHVAKDIGK
IARPREIHVVPELPKTRSGKIMRRLLRDVADGRELGDTSTLVDPSVFEAIRASK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcacctcgacgaagcactccgacgttccgtccgtgtatccaccctccgaagag
ttcgccgcacaggcgaatgcgacggaggagttgtaccgcgacgccgaggccgatcggctc
gcgttctgggccaagcaggccgagcggctggcgtgggacaccccgttcaccgaggtgctg
gactggtcggaggcgccgttcgcgaagtggttcgtcggcggcaagctcaacgtcgcctac
aactgcgtggaccgccatgtcgaggcgggcaacggcgaccgggtggcgattcactggcag
ggcgaaccggccgacgacacccgcgacatcacctacgcgcagttgcagaccgacgtgtgc
aaggccgcgaacgcactcaccgagatgggccttgttgcaggcgacagggtcgccatctac
atgccgatgctgcccgaggcgatcgtctcgatgctggcgtgcgcccggctgggcatcatg
cactccgtcgtgttcgcaggattctctgcgacagcgctcgccgcccgcatcgaggacgcc
gaagcgaagctggtgatcaccagcgacgggcagttccgtcgcggccaggcggtgtccctc
aaggacgcggtggacgaggcctgcaagggccaggattcgatcgaacacgttcttgtggtg
cgccgcaccgggattgacacaccgtggtccgagggccgggacctgtggtggcacgacacc
gtcgacccggcatcggccgagcacacgccggaggcgttcgattccgaacacccgctcttc
ctgctgtacacatcaggaaccaccggtaagcccaagggcatcatgcacaccaccggcggc
tacctgacccaagcgtcgttcacgcaccactacgtcttcgacatcaagcccgaaaccgac
gtgtattggtgcaccgctgacatcggctgggtcaccggccatacctacatcgtctacggg
ccgctatcgaacggcgcgacgcaggtggtctacgagggcacaccgaactcgcctgacgag
caccggcacttccaggtcatcgaaaagtacggcgtcaccatctattacacggcgccgacg
ctggttcgcatgttcatgaagtggggccgcgagttccccgacgcccacgacctgtcgagc
ctgcgcctactcggatcggtcggcgaaccgatcaatccggaggcgtggcggtggtaccgg
gatgccttcggcggcaacagaactccgatcgtcgacacgtggtggcagacagagaccggg
gccatcatgatctcgccgctgcccggcgtcaccgcagccaagcccggctctgcgatgaag
ccgctgcctggtatctcggcgatcatcgtggatgaagaaggaaaagagttggtgcccggc
gcggacgaggccgaacacgtgaccggctatctggtgctggacaaaccgtggcccgccatg
ctgcgcggcatctggggcgatccggaacggtacaaggagacctactggtcgcgctacggc
aagcagggctggtacttcgcgggcgacggcgcgcgggtcgactccgacgggtcgatctgg
ctgctcggtcgcatcgacgacgtgatgaacgtatccgggcaccggatctcgaccaccgaa
gtggaatcggcgttggtcggtcactcccatgtcgcagaagccgctgtcgtcggcgcgagc
gacgagaccaccggccagggcatctgcgcgttcgtcattctcgagtcgcatgccaagcac
cgcgacaacgacgagatgacccaggaactccgcgaacacgttgccaaggacatcggcaag
atcgccaggccgcgcgagatccacgtcgtgcccgagctgccgaagacccgcagcggcaag
atcatgcgcaggctgctgcgcgatgtcgcggacggacgtgaactcggcgacacctctact
ctggtggaccccagcgtgttcgaagcgatccgagcgtcgaagtaa

DBGET integrated database retrieval system