KEGG   Mycobacterium rhodesiae: MycrhN_2194Help
Entry
MycrhN_2194       CDS       T01685                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MycrhN_2194
Enzymes [BR:mrh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MycrhN_2194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2226223..2227026
Genome map
AA seq 267 aa AA seqDB search
MQVMGVVNVTDDSFSDGGLFLDRDRAVAHGLALAAEGAAIIDVGGESTRPGATRIDPEVE
ASRVVPVIKELAGQGITVSIDTMHAAVARAALDSGARIVNDVSGGRADPDMAPLLADAKV
PWVLMHWRSVGAARPHDAPAYRDVVAEVRDELMAGVDAAVAAGVDTENLIIDPGLGFAKN
AQHNWALLRALPEFVSTGFPVLVGASRKRFLGSLLASPDGEIRPPDGRETATAVISALAG
LHGAWGVRVHDVRASVDAIKVLEAWHG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcatgggagtcgtgaacgtcaccgacgactccttctccgacggtggactgttc
ctcgaccgtgaccgtgcggtcgcccacggcctggcgctggcggccgaaggtgccgcgatc
atcgacgtcggaggcgagtcgacgcgtccgggtgccacccgcatcgaccccgaggtcgag
gcatcacgcgtggtaccggtcatcaaagagcttgccggacagggcatcacggtcagcatc
gacaccatgcacgccgcggtggcgcgcgccgcactggacagcggcgcgcggatcgtcaac
gacgtgtccggcgggagggctgatcctgacatggcaccgctgctcgccgacgcgaaggtt
ccgtgggtgcttatgcactggcgatcggtcggcgccgcccgtccgcacgacgcgcccgcc
taccgcgacgtcgtcgccgaggtgcgcgacgagctgatggccggtgtcgacgccgcggtg
gcggccggcgtggacaccgagaacctgatcatcgatccgggactgggattcgccaagaac
gcacaacacaattgggcgctgctgcgggcgctgcccgagttcgtcagcaccggcttcccg
gtattggtcggcgcatcccgcaagcggtttctgggctcgctgctcgcgtcccccgacggt
gaaatccggccgcctgacggcagggagacggcgacggcggtgatctcggcgcttgccgga
ctgcacggggcgtggggtgtgcgggtgcatgacgtccgggcgtccgtcgacgctatcaag
gtcctcgaggcctggcatggctga

DBGET integrated database retrieval system