KEGG   Mycobacterium rhodesiae: MycrhN_2196Help
Entry
MycrhN_2196       CDS       T01685                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mrh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2227410..2227922
Genome map
AA seq 170 aa AA seqDB search
MTSVVLSIGSNLGDRLARLQSVVDGLGDAVRAVSPVYETDPWGGVEQDPFLNAVVLADDA
ALDGRGWLHRAQEFERAAQRVREERWGPRTLDVDLVMCSDGGREVTSDDDELTLPHPLAH
ERAFVLVPWLAVDPAAVLTVGGERRSVVKLLAELDPAERDGVRRTDAVLG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagtcgtcttgtccatcggatcgaatctcggcgacaggttggcgcgactgcag
tcggtcgtcgacggactcggcgatgcagtgcgcgctgtctcgccggtatacgagaccgat
ccgtggggcggcgtggaacaggacccgtttctcaacgctgtcgtgctcgccgacgacgcc
gccctcgacggccgaggatggctgcatcgggcccaggaattcgaacgcgccgcgcagcgc
gtacgcgaagagcgctggggcccacgcaccctcgacgtcgacctcgtcatgtgcagcgac
ggtggtcgtgaggtcacatcggacgatgacgagctgacgctgccgcacccgctcgcgcat
gagcgcgcgttcgtgctggtgccgtggctcgccgtcgaccccgccgccgtcctgacggtc
ggcggtgagcggcggtcggtcgtcaaactgctcgccgaactcgaccccgccgagcgtgac
ggtgtccgcaggaccgacgcggtgctgggctga

DBGET integrated database retrieval system