KEGG   Mycobacterium rhodesiae: MycrhN_2254Help
Entry
MycrhN_2254       CDS       T01685                                 

Definition
dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_2254
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MycrhN_2254
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MycrhN_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2279744..2280490
Genome map
AA seq 248 aa AA seqDB search
MTELAGRTALVTGGASGIGEACARELAARGAVVTVADRDDVGAKSVAEDIGGKAWAVDLS
DVSALEGLALDTDILVNNAGVQHVSPIPDFAPDRFRHLMTLMVESPFLLIRAALPHMYEL
NFGRIINISSVHGLRASEYKAAYVTAKHGLEGLSKVTALEGAPHGVTSNCVNPGYVRTPL
VTKQIADQAKVHDVPEDKVVTDILLKESAIKRLVEPEEIGALVGWLASPMAGMVTGASYT
MDGGWSAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcgcggggcgcacagcgctcgtcaccggcggcgcgagcggtatcggcgag
gcgtgcgcacgggaactggctgcgcggggagcggtcgtgaccgtggcggaccgcgacgat
gtcggcgcgaagtctgtcgccgaggacatcggcggaaaagcctgggccgttgacctttcc
gacgtctcggcgctcgaaggcctcgcactcgacactgacatcctggtcaacaacgcaggc
gtgcaacacgtcagtccgatccccgacttcgcaccggatcgctttcgccatctgatgacg
ctcatggtggaatcgccgttcctgctcatccgcgccgcattgccgcacatgtacgaacta
aacttcgggcggatcatcaacatctcctctgtgcacgggctcagggcatcggagtacaag
gccgcctacgtcaccgccaaacacggactcgagggcctgtcgaaggtcaccgctctcgag
ggtgcgccgcacggggtgacgagcaattgcgtgaatcccgggtatgtgcgaaccccactg
gttaccaagcagatcgccgatcaggccaaggtgcacgacgtcccggaggataaggtggtg
accgacatcctcctgaaggagagcgccatcaaacgtctggtggaacccgaggaaataggg
gccctcgtgggctggctggcgtcgccgatggcgggcatggtgaccggcgcgtcgtacacc
atggacgggggttggagcgcgcgatga

DBGET integrated database retrieval system