KEGG   Mycobacterium rhodesiae: MycrhN_2318Help
Entry
MycrhN_2318       CDS       T01685                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00071  Fatty acid degradation
mrh00280  Valine, leucine and isoleucine degradation
mrh00281  Geraniol degradation
mrh00310  Lysine degradation
mrh00360  Phenylalanine metabolism
mrh00362  Benzoate degradation
mrh00380  Tryptophan metabolism
mrh00410  beta-Alanine metabolism
mrh00627  Aminobenzoate degradation
mrh00640  Propanoate metabolism
mrh00650  Butanoate metabolism
mrh00903  Limonene and pinene degradation
mrh00930  Caprolactam degradation
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01212  Fatty acid metabolism
Module
mrh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MycrhN_2318
   00650 Butanoate metabolism
    MycrhN_2318
  Lipid metabolism
   00071 Fatty acid degradation
    MycrhN_2318
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MycrhN_2318
   00310 Lysine degradation
    MycrhN_2318
   00360 Phenylalanine metabolism
    MycrhN_2318
   00380 Tryptophan metabolism
    MycrhN_2318
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MycrhN_2318
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MycrhN_2318
   00281 Geraniol degradation
    MycrhN_2318
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MycrhN_2318
   00627 Aminobenzoate degradation
    MycrhN_2318
   00930 Caprolactam degradation
    MycrhN_2318
Enzymes [BR:mrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MycrhN_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF659
Motif
Other DBs
NCBI-ProteinID: AEV72908
UniProt: G8RU65
Position
complement(2346517..2347323)
Genome map
AA seq 268 aa AA seqDB search
MSDEEKSANGPDALIEQRGHTLIVTMNRPEKRNALSTEMMSIMVDAWNRVDEDPEIRTCI
LTGAGGYFCAGMDLKKADQQSPGDSFKGGFDPTRIDALLKGRRLTKPLIAAVEGPAIAGG
TEILQGTDIRVAGESAKFGVSEAKWSLYPMGGSAVRLVRQIPYTIACDILLTGRHLTAAE
AKEIGLIGYVVPDGSALDKALEIAEVINNNGPLAVQAILKTIRETEGMHENDAFKPDTQN
GIPVFLSEDSKEGPKAFLEKRKPVWKMK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgaagaaaaatctgcaaatggccccgacgccctcattgagcagcgcggacac
accttgatcgtcaccatgaaccgcccggagaagcgcaacgcgctttccaccgagatgatg
tcgatcatggtcgacgcgtggaaccgcgtcgacgaagatccggagatccgcacgtgcatc
ctcaccggtgccggtggctacttctgcgcgggcatggacctcaagaaggccgatcagcag
tcccccggtgacagcttcaagggcggcttcgacccgacacgcatcgacgcattgctcaag
gggcgccgcctgaccaagccgctgatcgcggcggtcgagggtccggccatcgcgggcggc
accgagatcctgcagggcaccgacatccgggtggcgggcgagagcgccaagttcggcgtc
tcggaggccaagtggagcctgtacccgatgggcggctccgcggtccgtctggtccgccag
attccctacacgatcgcctgcgacatcttgctgaccggtcgccacctcaccgccgccgag
gccaaggagatcggtctgatcggctacgtggtgcccgacggctcggcgctggacaaggcc
ctggagatcgccgaggtgatcaacaacaacggtccgctcgcggttcaggcgatcctgaag
accattcgcgagaccgaaggcatgcacgagaacgacgcgttcaagccggacactcagaac
ggcattccggtcttcctctccgaggactccaaggaggggccgaaggcgttcctggagaag
cgcaagcccgtttggaagatgaagtag

DBGET integrated database retrieval system