KEGG   Mycobacterium rhodesiae: MycrhN_2471Help
Entry
MycrhN_2471       CDS       T01685                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mrh  Mycobacterium rhodesiae
Brite
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     MycrhN_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2495627..2496670
Genome map
AA seq 347 aa AA seqDB search
MTALVIGANGYLGSHVTRQLVESGHDVRVMVRDGANTIGIDDLTTTRFIGDIWDNDTLRA
AMSGVDDVYYCVVDTRGWLRDPAPLFHTNVEGTRNVLEIAKDAGLHRFIFTSSYVTVGRR
RGHVATEDDDIDGRSPTFRLRRLTPYVRSRVQAEKLVLSYAREQGPPAIAMCVSTTYGAG
DWGGTPHGAIIAGAAFQKLPFVMDKIELEAVGVDDAARALLLAAEKGRIGERYLISEKMI
SNAEVVRIAAEAAGVGPPTKSIPLPLSYAMAALGSVKAKLRGTDEQLSLGSLRLMRAEAP
VDCSKARRELGWEPRPVEESIREAARFWVGLREARRRSKSPSKGATG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgctggtcatcggcgccaacggctatctcgggtcgcatgtcacgcgccagctc
gtcgaatccggtcacgatgttcgcgtgatggtgcgtgacggcgccaacacgatcggtatc
gacgacctcaccacgacgcggttcatcggcgacatctgggacaacgacaccctgcgagcg
gcgatgtccggcgtcgacgacgtctactactgcgtcgtcgacacccgcggttggctgcgc
gatccggcgccgttgttccacacaaacgtcgaaggcacgcgcaacgtgctcgagatcgcg
aaagatgctgggctgcaccggttcatcttcaccagcagctatgtcaccgtcggccgcagg
cgcgggcacgtcgccaccgaggacgacgacatcgacggaaggtcgccgacctttcggctc
cggagattgaccccgtacgtccgctcacgcgtacaggccgaaaagctcgtgttgtcctat
gcacgcgagcaggggccgcccgccatcgcgatgtgtgtgtccacgacatatggcgcaggc
gactggggcggtaccccgcacggcgcgatcatcgcgggcgcggcgtttcagaagctgccg
ttcgtgatggacaagatcgaactggaggcggtcggtgtcgacgacgcggcccgcgcgctg
ctgctggctgccgaaaaagggcggatcggcgagcgctacctgatctcggagaagatgatc
agtaacgccgaggtggtgcgcatcgctgccgaggcggccggtgttgggccgccgaccaag
tcgattccgctgcccctgtcctacgcaatggcagcgctgggcagcgtgaaggccaagctt
cgcggtacagacgaacaattgtcgttgggctcgctgcggctcatgcgtgccgaggcgccc
gtcgactgcagcaaggcccggcgggaattgggctgggagccgcgacctgtcgaggagtcg
atccgtgaggcggcgcggttctgggtggggctgcgcgaggcaaggcgtaggagcaagtcc
ccgtcgaagggggcaactggctag

DBGET integrated database retrieval system