KEGG   Mycobacterium rhodesiae: MycrhN_2906Help
Entry
MycrhN_2906       CDS       T01685                                 

Definition
(RefSeq) 1-aminocyclopropane-1-carboxylate deaminase
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MycrhN_2906
Enzymes [BR:mrh01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     MycrhN_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2907274..2908248
Genome map
AA seq 324 aa AA seqDB search
MNRLLGLPRVPLATLPTPLHPAPRLSEAIGVEVWLKRDDLTGLGLGGNKVRGLEYLIGDA
LAQGCDCLVTGAGPQSNWAMLSALAARRCGLDPHLVFYGSPVSPTGNLLLDELIGAEVHY
TGEPDRTSVDAGIEALAEKLRAAGRRPYILPRGGATALGSAGYLRASLELAGQLVDSCLA
PAQLWLASGSCGTQAGLVAGARWLRTPYEVIGVSVSRPEEECTHRVRALAEDAAELLGLP
GNDPTGTAEDVTVLGGHIGPGYGKPSEEGAAAAELVARTEGVFLDPVFAAKAMGALLRSA
PAGPVVFLVSGGTPTLFAARKESM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggctgttggggctgccccgcgtcccgctggccaccctgcccaccccattgcac
cccgctccccggttgtccgaggccatcggggtcgaggtgtggctcaagcgcgacgacctc
accgggcttggcttgggcggcaacaaggtgcgtggcctggaatacctgatcggcgacgct
ctcgcccagggctgcgattgcctggttaccggggcgggcccgcagtcgaactgggcgatg
ctgtctgcgctcgccgcgcgtcgttgcgggctcgatccgcacctggtgttctacggctcg
cccgtgtcgcccaccggcaacctgctgctcgacgagctgatcggcgccgaggtgcactac
accggcgaacccgaccgcacctcggttgacgccgggatcgaggccctcgccgagaagctg
cgcgcggccggtcgccgcccgtacatcctgccccgcgggggcgcgaccgccctgggctcg
gccggttacctacgggcgagcctggaactggccgggcaactggtagactcctgcctcgct
cccgcccagctgtggctggcctccggctcctgcggcacgcaggctggcctggtcgcggga
gcccgctggctgcggacgccgtatgaggttatcggggttagcgtgagccgtccggaggag
gaatgcacccaccgggtcagggccctcgccgaggatgctgccgagctgctcgggctcccc
ggcaacgacccgaccggcacggcggaggacgtgaccgtgcttggcggccacatcggtccg
ggctacgggaagccgtcggaagaaggtgctgccgcggccgaactggttgcgcgcaccgag
ggcgtgttcctggatccggtgtttgccgccaaggcgatgggcgcgctgctgcggagtgcg
cccgccggcccggtggtattcctggtcagcggtggcacacccacgctgttcgcggcccgg
aaggagtcgatgtga

DBGET integrated database retrieval system