KEGG   Mycobacterium rhodesiae: MycrhN_2906Help
Entry
MycrhN_2906       CDS       T01685                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
mrh  Mycobacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2907274..2908248
Genome map
AA seq 324 aa AA seqDB search
MNRLLGLPRVPLATLPTPLHPAPRLSEAIGVEVWLKRDDLTGLGLGGNKVRGLEYLIGDA
LAQGCDCLVTGAGPQSNWAMLSALAARRCGLDPHLVFYGSPVSPTGNLLLDELIGAEVHY
TGEPDRTSVDAGIEALAEKLRAAGRRPYILPRGGATALGSAGYLRASLELAGQLVDSCLA
PAQLWLASGSCGTQAGLVAGARWLRTPYEVIGVSVSRPEEECTHRVRALAEDAAELLGLP
GNDPTGTAEDVTVLGGHIGPGYGKPSEEGAAAAELVARTEGVFLDPVFAAKAMGALLRSA
PAGPVVFLVSGGTPTLFAARKESM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggctgttggggctgccccgcgtcccgctggccaccctgcccaccccattgcac
cccgctccccggttgtccgaggccatcggggtcgaggtgtggctcaagcgcgacgacctc
accgggcttggcttgggcggcaacaaggtgcgtggcctggaatacctgatcggcgacgct
ctcgcccagggctgcgattgcctggttaccggggcgggcccgcagtcgaactgggcgatg
ctgtctgcgctcgccgcgcgtcgttgcgggctcgatccgcacctggtgttctacggctcg
cccgtgtcgcccaccggcaacctgctgctcgacgagctgatcggcgccgaggtgcactac
accggcgaacccgaccgcacctcggttgacgccgggatcgaggccctcgccgagaagctg
cgcgcggccggtcgccgcccgtacatcctgccccgcgggggcgcgaccgccctgggctcg
gccggttacctacgggcgagcctggaactggccgggcaactggtagactcctgcctcgct
cccgcccagctgtggctggcctccggctcctgcggcacgcaggctggcctggtcgcggga
gcccgctggctgcggacgccgtatgaggttatcggggttagcgtgagccgtccggaggag
gaatgcacccaccgggtcagggccctcgccgaggatgctgccgagctgctcgggctcccc
ggcaacgacccgaccggcacggcggaggacgtgaccgtgcttggcggccacatcggtccg
ggctacgggaagccgtcggaagaaggtgctgccgcggccgaactggttgcgcgcaccgag
ggcgtgttcctggatccggtgtttgccgccaaggcgatgggcgcgctgctgcggagtgcg
cccgccggcccggtggtattcctggtcagcggtggcacacccacgctgttcgcggcccgg
aaggagtcgatgtga

DBGET integrated database retrieval system