KEGG   Mycobacterium rhodesiae: MycrhN_3315Help
Entry
MycrhN_3315       CDS       T01685                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_3315
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MycrhN_3315
   00640 Propanoate metabolism
    MycrhN_3315
   00660 C5-Branched dibasic acid metabolism
    MycrhN_3315
Enzymes [BR:mrh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MycrhN_3315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3316918..3318081
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDSAEDAKAIAEEIGKPVMVKAQVKVGGRGKAGGVK
YAATPDDAFTHAQNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVKGVDLATARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VAEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHAEFEDKDATDPLELKAKEH
DLNYVKLDGSVGIIGNGAGLVMSTLDVTAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDAQVKSVFVNVFGGITSCDAVATGIVNALKILGDEANKPLVVRLDGNNVEEGRRIL
AEANHPLVIQADTMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgaataccaagccaaagagctgttcgccaagcacaacgtgccgaccaca
cctggccgcgtcaccgattccgccgaggacgccaaggcgatcgccgaggagatcggcaag
cccgtcatggtcaaggcgcaggtgaaggtgggtggacgcggcaaggccggcggcgtgaag
tacgccgcgacccccgacgacgccttcacgcacgcccagaacatcctgggtctcgacatc
aagggccacgtcgtcaagaagctgctggtcgccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctcgatcgtgccaaccgcacgtacctggcgatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgccgcgaccaagcccgagcggttggccaaggtgccc
gtcaacgccgtcaagggggtcgacctggcgacggcccggtcgatcgccgagcagggccac
ctcccagccgaggtcctcgacgccgccgcagtgaccatccagaagctgtgggaggtgttc
gtcgcggaggacgccactctggtcgaggtcaacccgctggtgcgcactcccgacgaccag
atcctcgccctcgacggcaaggtcacgctcgacgcgaacgccgacttccgccagcccggt
catgcggagttcgaggacaaggacgcgaccgacccgctggagctcaaggccaaggagcac
gacctcaactacgtcaagctcgacggttcggtcggcatcatcggtaacggcgccgggctc
gtcatgtcgacgctggacgtcaccgcctacgcgggggagaagcacggcggagtgaagccg
gccaacttcctcgacatcggtggcggcgcgtcggccgaggtcatggccgcgggtctggac
gtcatcctcaacgacgctcaggtcaagagcgtcttcgtgaacgtgttcggcggcatcacc
tcctgcgacgcggtcgcgaccggcatcgtcaacgcgctgaagattctcggtgacgaggcc
aacaagccgctggtcgtccgtctcgacgggaacaacgtcgaagaggggcgccggatcctg
gccgaggccaatcacccgctggtcatccaggccgacaccatggacgccggtgccgacaaa
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system