KEGG   Mycobacterium rhodesiae: MycrhN_3325Help
Entry
MycrhN_3325       CDS       T01685                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MycrhN_3325
Enzymes [BR:mrh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MycrhN_3325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3327958..3329343
Genome map
AA seq 461 aa AA seqDB search
MVTSPNDLPRTVGELRASGHVERGVKEEIRENLLAALAEGRDAWPGILGFSDTVIPQLER
ALIAGHDVVLLGERGQGKTRLLRALTGLLDEWTPVIAGAELSEHPYSPITPESIRRAADS
GDDLPVEWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHR
GIVAINELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVVVVASANPEDYTNRGRIIT
PLKDRFGAEIRTHYPYELEVEVGVIRQESHLSAEVPDYLLHVLARFARYLRESRSIDQRS
GVSARFAIAAAETVAASARHRSAVLGEQDPVARVVDLSTVIDVLRGKLEFESGEEGREQA
VLEHLLRRATADTAQRLLGGIDVGPLVVAIENGSAVTTGERVSSREVLAAVPEVPAIAEI
QKRLAATTDGQRAAAVELALEALYLAKRIDKVSSEGETVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacatcacctaacgatttgccccggaccgtcggagagctgagggcctccggtcat
gtggagcggggagtcaaggaagaaatccgggagaacctgctggcggcgctggccgagggg
cgtgatgcgtggccgggcatcctcggcttctccgacaccgtgatcccgcaactcgagcgc
gccctgatcgccggacacgacgtggtgctgctgggcgaacgcggacagggcaagacccgt
ctgctgcgcgcgctgaccggcctgctcgacgaatggacccccgtcatcgcgggcgcggaa
ctgagcgagcatccgtactcgccgatcacccccgagtcgatccggcgagccgcagactcc
ggcgacgacctgcccgtcgaatggcgccaccgcagcgagcgctataccgagaagctggcc
accccggacaccagcgtggccgatctggtcggtgacatcgaccccatcaaggtggccgag
ggtcgcagcctcggtgaccccgagaccatcgcctatggcctgattccccgggcgcaccgc
ggcatcgtcgcgatcaacgaattgcccgacctcgccgagcgcatccaggtgtcgatgctg
aacgtgatggaggagcgcgacatccaggtgcgcggttacacgctgcggctgccgctggac
gtcgtcgtcgtcgccagcgccaaccccgaggactacacgaaccgcgggcgcatcatcacg
ccgctcaaggaccgcttcggcgccgagatccgcacgcactacccgtacgagctcgaggtc
gaggtcggcgttatccggcaggagtcacatctgtccgccgaggtgcccgactacctgctg
cacgtgctcgcccggttcgcccgttatctgcgggagtcgcgctcgatcgaccagcgttcc
ggcgtctccgcgcgcttcgcgatcgcggccgccgagacggtcgcggcgtcggccaggcac
cgctcggccgtactgggcgaacaggacccggtcgcacgcgtcgtcgacctgtcgacggtg
atcgacgtgctgcgcggcaagctggaattcgaatccggcgaggagggtcgcgagcaggct
gtgctcgaacacctgttgcgccgcgccaccgcggacaccgcacagcggctgctgggcggt
atcgacgtcggcccgctcgtcgtcgccatcgagaacgggtcggccgtcaccaccggcgag
cgcgtgtcctcgcgcgaggtgctcgctgcggtgccggaggtcccggcgatcgccgagatc
cagaagcggctggcggcgacgaccgacgggcagcgtgcggcggccgtcgagctggcgctg
gaggcgctgtatctggccaagcgcatcgacaaggtgtcctcggaaggcgaaaccgtctat
ggctaa

DBGET integrated database retrieval system