KEGG   Mycobacterium rhodesiae: MycrhN_3325Help
Entry
MycrhN_3325       CDS       T01685                                 

Definition
(GenBank) Mg-chelatase subunit ChlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00860  Porphyrin and chlorophyll metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MycrhN_3325
Enzymes [BR:mrh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MycrhN_3325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat AAA_3 MCM AAA_PrkA AAA_16 ABC_tran RuvB_N NACHT AAA_22 DLIC
Motif
Other DBs
NCBI-ProteinID: AEV73850
UniProt: G8RPW6
Position
3327958..3329343
Genome map
AA seq 461 aa AA seqDB search
MVTSPNDLPRTVGELRASGHVERGVKEEIRENLLAALAEGRDAWPGILGFSDTVIPQLER
ALIAGHDVVLLGERGQGKTRLLRALTGLLDEWTPVIAGAELSEHPYSPITPESIRRAADS
GDDLPVEWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHR
GIVAINELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVVVVASANPEDYTNRGRIIT
PLKDRFGAEIRTHYPYELEVEVGVIRQESHLSAEVPDYLLHVLARFARYLRESRSIDQRS
GVSARFAIAAAETVAASARHRSAVLGEQDPVARVVDLSTVIDVLRGKLEFESGEEGREQA
VLEHLLRRATADTAQRLLGGIDVGPLVVAIENGSAVTTGERVSSREVLAAVPEVPAIAEI
QKRLAATTDGQRAAAVELALEALYLAKRIDKVSSEGETVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacatcacctaacgatttgccccggaccgtcggagagctgagggcctccggtcat
gtggagcggggagtcaaggaagaaatccgggagaacctgctggcggcgctggccgagggg
cgtgatgcgtggccgggcatcctcggcttctccgacaccgtgatcccgcaactcgagcgc
gccctgatcgccggacacgacgtggtgctgctgggcgaacgcggacagggcaagacccgt
ctgctgcgcgcgctgaccggcctgctcgacgaatggacccccgtcatcgcgggcgcggaa
ctgagcgagcatccgtactcgccgatcacccccgagtcgatccggcgagccgcagactcc
ggcgacgacctgcccgtcgaatggcgccaccgcagcgagcgctataccgagaagctggcc
accccggacaccagcgtggccgatctggtcggtgacatcgaccccatcaaggtggccgag
ggtcgcagcctcggtgaccccgagaccatcgcctatggcctgattccccgggcgcaccgc
ggcatcgtcgcgatcaacgaattgcccgacctcgccgagcgcatccaggtgtcgatgctg
aacgtgatggaggagcgcgacatccaggtgcgcggttacacgctgcggctgccgctggac
gtcgtcgtcgtcgccagcgccaaccccgaggactacacgaaccgcgggcgcatcatcacg
ccgctcaaggaccgcttcggcgccgagatccgcacgcactacccgtacgagctcgaggtc
gaggtcggcgttatccggcaggagtcacatctgtccgccgaggtgcccgactacctgctg
cacgtgctcgcccggttcgcccgttatctgcgggagtcgcgctcgatcgaccagcgttcc
ggcgtctccgcgcgcttcgcgatcgcggccgccgagacggtcgcggcgtcggccaggcac
cgctcggccgtactgggcgaacaggacccggtcgcacgcgtcgtcgacctgtcgacggtg
atcgacgtgctgcgcggcaagctggaattcgaatccggcgaggagggtcgcgagcaggct
gtgctcgaacacctgttgcgccgcgccaccgcggacaccgcacagcggctgctgggcggt
atcgacgtcggcccgctcgtcgtcgccatcgagaacgggtcggccgtcaccaccggcgag
cgcgtgtcctcgcgcgaggtgctcgctgcggtgccggaggtcccggcgatcgccgagatc
cagaagcggctggcggcgacgaccgacgggcagcgtgcggcggccgtcgagctggcgctg
gaggcgctgtatctggccaagcgcatcgacaaggtgtcctcggaaggcgaaaccgtctat
ggctaa

DBGET integrated database retrieval system