KEGG   Mycobacterium rhodesiae: MycrhN_3350Help
Entry
MycrhN_3350       CDS       T01685                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MycrhN_3350
   00052 Galactose metabolism
    MycrhN_3350
   00500 Starch and sucrose metabolism
    MycrhN_3350
   00520 Amino sugar and nucleotide sugar metabolism
    MycrhN_3350
Enzymes [BR:mrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MycrhN_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3352168..3353079
Genome map
AA seq 303 aa AA seqDB search
MTRAEVPIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVI
ITSEGKDGVVAHFVEDLVLEGTLEARGKHVMLEKVRRAAALIKVESVVQAEPLGLGHAVS
CVESVLTDEDDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVPRDEISAYGVFD
VEPVADTNNPNVLRVKGMVEKPKAEDAPSLYAAAGRYVLDRAIFDALRRVKHGAGGEIQL
TDAIALLIDEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALERDDYGPELRRWLVERLGL
IDC
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacacgggccgaggtaccgattccacgcacggcggtcgtccctgctgcaggcctggga
acacgatttctgcccgccactaagacggtgcccaaggaactgttgcccgtcgtcgacacg
ccggggatcgagctggtggctgccgaggctgctgaggccggtgccgaacggctcgtcatc
atcacgtccgaaggcaaggacggggtggttgcccacttcgtcgaggaccttgttctcgag
ggcacgctggaagcgcgcggcaagcacgtgatgctggagaaggtgcgccgagccgcggcg
ctcatcaaggtcgaatcggtggtccaggccgaaccgctgggcctcggccatgccgtcagc
tgtgtggaaagcgtcctgacggacgaagacgacgctatcgcggtgctgttgcccgacgac
ctcgtgttgcccaccggggtgctcgagacgatgtcgaaagtccgtgccaagcgcggcggt
tcggtgttgtgcgcgatcgaggtgcctcgagacgagatcagcgcctacggcgtcttcgac
gtcgaacccgtcgccgacaccaacaatccgaacgtgctgcgcgtcaagggcatggtggag
aagccgaaggccgaggacgcgccgtcgctgtatgccgccgcgggccgctacgtcctcgac
cgggcgatattcgacgcgctcaggcgggttaagcacggtgccggcggtgagatccagttg
accgacgcgatcgctctgctgatcgacgaaggacatccggtgcacgtcgtcgtacatcgc
ggttctcgacacgacctcggaaatcccggcggctacctcaaggctgcggttgactttgcc
ttggagcgcgacgactacggacccgagctacggcggtggttggtcgagcgcctggggctg
atcgattgctga

DBGET integrated database retrieval system