KEGG   Mycobacterium rhodesiae: MycrhN_3571Help
Entry
MycrhN_3571       CDS       T01685                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mrh00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3566732..3567106)
Genome map
AA seq 124 aa AA seqDB search
MTQTPDALVTEFCKKWASPDAAELAGYFTEDGIYHNIPMDPVQGPQAIAEFIAGFTAAFD
GIDFQVHKQVSGGNIVMNERTDVMRRKDGGEIALPVMGVFEVVHGKIARWSDYFDMETVT
KAFA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaacccccgacgcgctggtcaccgagttctgcaagaagtgggcctccccggat
gcggccgagcttgccggctatttcaccgaggacggcatctaccacaacatcccgatggat
cccgtgcagggaccccaagccatcgcggagttcatcgcgggcttcacggccgccttcgac
ggcatcgactttcaggtgcacaagcaggtcagcggcgggaacatcgtgatgaacgagcgc
accgacgtgatgcgccgcaaggacggcggtgagatcgcgcttccggtgatgggtgtgttc
gaggtcgtgcacggcaagatcgcgcggtggtcggactacttcgacatggagacggtgacg
aaggcgttcgcctaa

DBGET integrated database retrieval system