KEGG   Mycobacterium rhodesiae: MycrhN_3818Help
Entry
MycrhN_3818       CDS       T01685                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MycrhN_3818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MycrhN_3818
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MycrhN_3818
Enzymes [BR:mrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MycrhN_3818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3815085..3816194
Genome map
AA seq 369 aa AA seqDB search
MSPLSNGGTPSAARGTVHQPWPGLIAAYRDRLPVEDNWTPVTLREGGTPLLPAPRLSEYT
GCTVHLKVEGLNPTGSFKDRGMTMAVTEAVSRGQQVVLCASTGNTSASAAAYAARAGITC
AVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELARKLTNDYPTVSLVNSVNPYRIE
GQKTAAFEIVDALGFAPDVHSLPVGNAGNITAYWKGYTEYHRDSVSDRLPRMLGTQAAGA
APLVLGEPVSNPETIATAIRIGSPASWTTAVEAQQQSDGRFLAATDEEILAAYHLVARTE
GVFVEPASAASIAGLLKSIEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPVVSPLPVDPS
AVVEKLGLV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagccctctttccaatgggggtacccccagcgcagcgagggggactgttcaccagccc
tggcccggcttgatcgcggcataccgcgatcgtctgccggtcgaggacaactggactccg
gtcaccctgcgcgagggcgggactccgctgttgcccgcaccccggttatccgaatacacc
ggctgcacagtgcatttgaaggtcgaaggcctcaacccgacgggttccttcaaggaccgc
ggcatgacgatggccgtcaccgaggccgtctctcgcggccagcaggtcgtgctgtgcgct
tcgaccggcaacacctcagcgtcggcggccgcctatgcggcgcgggccggcatcacctgt
gcggtgctgataccgcagggcaagatcgcgatgggcaagctcgcccaggcggtgatgcac
ggcgccaagatcattcagatcgacggcaacttcgacgactgcctggagctggcccgcaaa
ctgaccaacgactatccgaccgtctcgctcgtcaactcggtcaacccgtaccgcatcgag
ggacagaagaccgccgcgttcgagatcgtcgatgccctcggcttcgcgccggacgtgcat
tccctgcccgtcggaaacgccggcaacatcacggcctactggaagggctacaccgaatat
caccgcgattcggtgtcggaccggttgccgcgcatgctcggcacgcaggccgcaggcgcc
gcccccctcgtattgggtgagccggtgagcaatcccgagacgatcgcgacggcgatccgg
atcggctcacccgcgtcgtggacgactgcggtcgaggcgcagcagcagtccgacggccgc
ttcctcgccgccacagacgaagagatactggccgcctatcacctggtggcacgcaccgag
ggtgtgttcgtcgagccggcgtcggcggccagcatcgccgggctgctcaagtcgatcgag
gatggctgggtggccaaggggtcgaccgtcgtgtgcacggtgacgggcaacggtctcaag
gaccccgacacggccctgaaggggatgccggtcgtctctccgctgccggtcgatccgtcc
gcggtggtcgagaagctgggcctggtctga

DBGET integrated database retrieval system