KEGG   Mycobacterium rhodesiae: MycrhN_4098Help
Entry
MycrhN_4098       CDS       T01685                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_4098
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_4098
   00020 Citrate cycle (TCA cycle)
    MycrhN_4098
   00620 Pyruvate metabolism
    MycrhN_4098
Enzymes [BR:mrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MycrhN_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4091689..4092867
Genome map
AA seq 392 aa AA seqDB search
MSEVRDFLVPDLGEGLEDATITSWSVAVGDTVELNETLCTVETNKAEVEIPSPYAGRITE
LGGAEGETLNVGAVLVRIATEAPAPVSKRNPVLVGYGADDDMDDSRRTPRPTSTRPRAKP
PVRKLAAELNVDLNELAGSGTDGVITREDVLSSAGRSEPTPDMVAVRGVRGEMARRMSLS
RREIPDAHAAVQVDGTSLLRLRDRIRERHGDGAAITPFVLTLRLLTIALTHHRDLNATWV
DTTAGPQVHLHSAVHLGFGVAAPRGLLVPVVKDAQDKTTRELAEVVGRLIEDARAGTLVP
TELQGSTFTVSNFGALGLDDGVPVINYPEAAILGMGSLKPRAVVVDGDVVARPTMSITCA
FDHRIVDGAQAAAFLTELRSLIEAPELALLDL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtgcgggactttctcgtgcccgatctcggcgagggtctcgaagacgcgacg
atcacgagctggagcgtcgcggtcggagataccgttgaactcaacgagacgctgtgcacg
gtcgagacgaacaaggccgaggtggagatcccgagcccgtatgccggacgcatcaccgag
ctcggcggggccgaaggagagacgctgaatgtcggtgcggtgctggtgcgtatcgccacg
gaagctcccgcccccgtttccaagcggaacccggtactcgtcggttacggcgccgacgac
gacatggacgacagcagacggaccccacgccccacgtcgacgcgaccgcgcgccaaaccg
ccggtgcgaaaactggcggccgagctgaacgtggacctcaacgagctcgcggggtccgga
actgacggggtgatcacccgcgaggatgtcctgtcgtcggcgggccggtcggagccgact
cccgacatggtggcggtgcgtggtgtgcggggcgaaatggcgcgccgaatgtcattgtcg
cgcagggagatacctgatgcccatgcggccgttcaggtggacgggacgagtctgttgcgg
ctgcgggaccggatacgcgaacgtcacggcgacggggccgcgatcacgccgttcgttctc
acgttgcggctgttgacgatcgcgctcacgcatcacagagatctcaacgcgacgtgggtc
gacaccaccgcgggtccgcaggttcatctgcactccgccgtgcatctgggattcggcgtg
gcggcgccgcgcggcctgctggtgcccgtcgtcaaagacgcgcaggacaagacgacccgc
gagctggccgaggtggtgggtcggctgatcgaggatgcccgtgccggcacgctggtgccg
accgaactgcagggctccacgttcaccgtatccaacttcggcgcgctgggactggacgac
ggtgtgccggtgatcaactatcccgaggcggccatcctcgggatgggctcgctgaagccg
cgtgccgttgtcgtcgacggagacgtcgtggcacggccgacgatgtcgatcacctgcgcg
ttcgaccatcgcatcgtcgacggcgcgcaggcggcggcgttcttgaccgaactgcggtcg
ctcatcgaggcgccggaactggcgctcctcgacctctag

DBGET integrated database retrieval system