KEGG   Mycobacterium rhodesiae: MycrhN_4258Help
Entry
MycrhN_4258       CDS       T01685                                 

Definition
succinate dehydrogenase/fumarate reductase flavoprotein subunit
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MycrhN_4258
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     MycrhN_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4260186..4261649)
Genome map
AA seq 487 aa AA seqDB search
MDTDVYPRPVSQIASWDLEADVVIAGYGIAGVAAAVEAASAGADVLVLERTGGWGGAAAM
AGGFIYLGGGTPLQKACGFDDSVDNMAAFLNVAMGPGADADRVGDYCAGSVEHFDWLVRC
GVPFKPEFWGEPGWEPPGDQGLMFTGGENAYPFNTIAEPAPRGHIPQMANKKAGEASAGY
MLMKPLVETAAAAGVRAVYDVHASALAVESDGRVAGLVARQYGKPIAIRARRGVVLAAGS
FAYNDAMMAQFAPRLLGRPGASIEQHDGQAIRMAQALGADLAHMDATEVAFLVDPQQTVR
GILVNGRGQRYVPEDMYSGRIGQLTLYHQDDTAYLIIDGDAQEEAMAATSPTPFLKRPAT
WVCESVAELESEIGLPAGVLQDTVRVYNDNAARGEDPLLHKKPEWLKPIGTPVGAIDLRA
SCAGFTLGGLQTTLDSEVLHVSGAPIPGLYAAGRCTAGVAAWGYASGISLGDGSFYGRRA
GRAAAKN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggacacagacgtctacccaaggccagtcagccagatcgcgagctgggatctcgaagcc
gatgtcgtgatcgccgggtacggcatcgccggggtggccgcggcggtcgaggccgcctcg
gcaggcgccgacgtgctcgtcctggagcgcaccggcgggtggggcggggcggccgccatg
gcaggcggtttcatctacctcggcggcgggaccccgctgcaaaaagcttgtggtttcgac
gattccgtcgacaacatggctgcattcctcaatgtcgcgatgggaccgggcgcggacgcg
gaccgagtcggcgactactgtgcaggaagcgtcgaacacttcgactggctggtgcgctgc
ggtgtgccgttcaaaccggagttctggggtgagcccggctgggaaccgcccggcgaccaa
gggctgatgttcaccggcggcgagaacgcctatccgttcaacaccatcgccgaaccagct
ccgcgcggccatattccgcagatggcgaacaagaaggccggcgaagccagtgccggctac
atgctcatgaagcccctcgtcgaaactgcagccgccgccggtgtgagggccgtctacgac
gtacacgcttccgcgttggccgtggagtccgacggtcgcgtcgcggggctggtcgcgcgc
cagtacgggaagcccattgcgatccgtgcgcgtcgcggcgttgtcctcgctgcgggcagc
ttcgcctacaacgacgcgatgatggctcaattcgcgccgcggcttctcggccgtcccgga
gcatcgatcgaacagcatgacgggcaggcgattcggatggcccaggcgctcggcgccgac
ctggcccacatggatgccaccgaggtggcgttcctcgtcgacccgcaacagacggttcgc
ggcatcctcgtcaacgggcgcggccagcgctatgtcccggaggacatgtactccgggcgg
atcgggcagctcacgctgtatcaccaggacgacaccgcctacctgatcatcgacggtgac
gctcaggaggaggcgatggccgcgacctccccgactccgttcctgaagcgcccggcgaca
tgggtgtgcgagtcggtcgcagaactcgaatccgagatcggactacccgccggggtattg
caggacaccgtccgcgtctacaacgacaacgcggcgcgcggcgaggatccgttactgcac
aaaaagcccgaatggctcaagcccatcggcacccccgtcggcgccatcgatctgcgagca
agttgcgccggcttcacgctcggggggctgcagaccaccttggactcagaggtgctgcac
gtcagcggcgcgccgatccccggtctttatgccgcgggccgctgcaccgcgggtgtggcc
gcctggggttacgcgagcgggatctctctgggcgacggcagcttctacggccgtcgcgcc
ggccgcgcggcagccaagaactga

DBGET integrated database retrieval system