KEGG   Mycobacterium rhodesiae: MycrhN_4492Help
Entry
MycrhN_4492       CDS       T01685                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_4492
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MycrhN_4492
  Amino acid metabolism
   00310 Lysine degradation
    MycrhN_4492
Enzymes [BR:mrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MycrhN_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4497723..4499570)
Genome map
AA seq 615 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTDKVDTEIPSPAAGVLKKIV
AQEDDTVEVGGELAVIGEEGESGGDDAGSDEKPDETSDEEPAEEEKPAEEPAAQEEPAAE
EQEDEPEPEPASEPESKPAAKSSGSATSVKMPELGESVTEGTVTRWLKKVGDTVEVDEPL
VEVSTDKVDTEIPSPVAGTLVSITAEEDDTVEVGGELAKIGDADAASDDEPEPEPEPEPE
PKEEPKEEKKPEPKAEPNEEPKAEPKEEPKQEPKPEPKAEPKEEPKAEPKSEPAAQAPSG
DGSPYVTPLVRKLAAENDIDLASVKGTGVGGRIRKQDVVAAAEAKKAPAAEPAAKAPSGG
AAPKEAPAPAPALAHLRGTTQKANRIRQITAKKTRESLQATAQLTQTHEVDMTKIVALRA
RAKNDFAEREGVNLTYLPFIARAVIDALKTHPNVNASYDEESKEITYYDAEHLGFAVDTE
QGLLSPVVKNAGDLSLAGLARAIADIAERARSGDLKPDELSGGTFTITNIGSQGALFDTP
ILVPPQAAMLGTGAIVKRPRVIVDSLGNESIGVRSVCYLPLTYDHRLIDGADAGRFVTTI
KRRLEEGAFEADLSL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgttcagatgcccgcactcggcgagagcgtgaccgaggggactgtcacc
cgctggctcaagcaagagggcgacacagtcgagcaagatgagccgctgctggaggtctcc
accgacaaggtcgacaccgagatcccttcgcccgccgcgggcgtgctgaagaagatcgtc
gcccaggaggacgacaccgtcgaggtcggcggcgagttggcggtgatcggtgaggagggc
gaatccggcggcgacgacgccgggtccgatgaaaagcccgacgaaacgtccgacgaggaa
cccgccgaagaagagaagccggccgaagagcctgccgctcaggaggaacccgccgccgaa
gagcaggaggacgaacccgagccggagcctgcatccgagcccgagtccaagccggccgcc
aagtcgtcgggctcggcgacatcggtgaagatgccagagctgggcgagtcggtgaccgag
ggcacggtgacccggtggctgaagaaggtcggcgacacggtcgaggtcgatgagccgctc
gtcgaggtgtcgacggacaaggtcgacaccgagatcccgtcgccggtggccgggacactt
gtgtcgatcaccgccgaagaagacgacaccgtcgaggtcggcggggagctggccaagatc
ggcgacgcggatgcggcgtccgacgacgaaccagagcccgagccggaacccgagccggaa
cccaaagaagagccgaaggaagaaaagaagccggagccgaaagccgagcccaacgaagaa
cccaaggccgagccgaaggaagagccgaagcaagagccgaagcccgaacccaaggctgag
cccaaagaagaacccaaggccgagccgaaatcggagcctgccgcccaagcaccgtcgggt
gacggctcgccgtacgtcactccgctggtgcgaaagctggcagcggagaacgacatcgac
ctcgcgtcggtgaagggaaccggtgtcggcggccggatccgcaagcaggacgtcgtcgcg
gcggcggaggccaagaaggccccggcggccgagcctgcggccaaggcgccgtcggggggc
gcggctcccaaggaggcgcccgcacccgcgccggctctggcgcacctgcgcggcacgacg
cagaaggccaatcggatccgtcagatcaccgcgaagaagacccgcgaatctctgcaggcc
acagcacagttgacgcagacgcacgaggtcgacatgaccaagatcgtggcgctgcgggca
cgcgcgaagaatgacttcgccgaacgcgagggcgtcaacctgacgtatctgccgttcatc
gcccgggcggtgatcgacgcgctgaagacgcatccgaacgtcaacgcgagctacgacgaa
gagtccaaggagatcacctactacgacgccgagcatctcgggttcgccgtcgacaccgaa
cagggtctgctctcaccggtggtcaagaacgccggtgacctgtcgctggccgggctggca
cgcgcgatcgccgacatcgccgagcgcgctcgctcgggcgacctcaagcccgacgagttg
tccggcggcacgttcaccatcacgaacatcggtagtcagggcgcactcttcgacaccccg
atcctggtcccgccgcaggcggcgatgctcggtaccggcgcgatcgtgaagcggccgcgg
gtgatcgtcgactccttgggcaacgagtcgatcggcgtgcgctcggtctgctacctgccg
ctgacctacgatcaccggctgatcgacggcgcggacgccggacgcttcgtgaccaccatc
aagcgccgcctcgaagagggcgcattcgaggccgatctaagcctgtaa

DBGET integrated database retrieval system