KEGG   Mycobacterium rhodesiae: MycrhN_4492Help
Entry
MycrhN_4492       CDS       T01685                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_4492
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MycrhN_4492
  Amino acid metabolism
   00310 Lysine degradation
    MycrhN_4492
Enzymes [BR:mrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MycrhN_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4497723..4499570)
Genome map
AA seq 615 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEQDEPLLEVSTDKVDTEIPSPAAGVLKKIV
AQEDDTVEVGGELAVIGEEGESGGDDAGSDEKPDETSDEEPAEEEKPAEEPAAQEEPAAE
EQEDEPEPEPASEPESKPAAKSSGSATSVKMPELGESVTEGTVTRWLKKVGDTVEVDEPL
VEVSTDKVDTEIPSPVAGTLVSITAEEDDTVEVGGELAKIGDADAASDDEPEPEPEPEPE
PKEEPKEEKKPEPKAEPNEEPKAEPKEEPKQEPKPEPKAEPKEEPKAEPKSEPAAQAPSG
DGSPYVTPLVRKLAAENDIDLASVKGTGVGGRIRKQDVVAAAEAKKAPAAEPAAKAPSGG
AAPKEAPAPAPALAHLRGTTQKANRIRQITAKKTRESLQATAQLTQTHEVDMTKIVALRA
RAKNDFAEREGVNLTYLPFIARAVIDALKTHPNVNASYDEESKEITYYDAEHLGFAVDTE
QGLLSPVVKNAGDLSLAGLARAIADIAERARSGDLKPDELSGGTFTITNIGSQGALFDTP
ILVPPQAAMLGTGAIVKRPRVIVDSLGNESIGVRSVCYLPLTYDHRLIDGADAGRFVTTI
KRRLEEGAFEADLSL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgttcagatgcccgcactcggcgagagcgtgaccgaggggactgtcacc
cgctggctcaagcaagagggcgacacagtcgagcaagatgagccgctgctggaggtctcc
accgacaaggtcgacaccgagatcccttcgcccgccgcgggcgtgctgaagaagatcgtc
gcccaggaggacgacaccgtcgaggtcggcggcgagttggcggtgatcggtgaggagggc
gaatccggcggcgacgacgccgggtccgatgaaaagcccgacgaaacgtccgacgaggaa
cccgccgaagaagagaagccggccgaagagcctgccgctcaggaggaacccgccgccgaa
gagcaggaggacgaacccgagccggagcctgcatccgagcccgagtccaagccggccgcc
aagtcgtcgggctcggcgacatcggtgaagatgccagagctgggcgagtcggtgaccgag
ggcacggtgacccggtggctgaagaaggtcggcgacacggtcgaggtcgatgagccgctc
gtcgaggtgtcgacggacaaggtcgacaccgagatcccgtcgccggtggccgggacactt
gtgtcgatcaccgccgaagaagacgacaccgtcgaggtcggcggggagctggccaagatc
ggcgacgcggatgcggcgtccgacgacgaaccagagcccgagccggaacccgagccggaa
cccaaagaagagccgaaggaagaaaagaagccggagccgaaagccgagcccaacgaagaa
cccaaggccgagccgaaggaagagccgaagcaagagccgaagcccgaacccaaggctgag
cccaaagaagaacccaaggccgagccgaaatcggagcctgccgcccaagcaccgtcgggt
gacggctcgccgtacgtcactccgctggtgcgaaagctggcagcggagaacgacatcgac
ctcgcgtcggtgaagggaaccggtgtcggcggccggatccgcaagcaggacgtcgtcgcg
gcggcggaggccaagaaggccccggcggccgagcctgcggccaaggcgccgtcggggggc
gcggctcccaaggaggcgcccgcacccgcgccggctctggcgcacctgcgcggcacgacg
cagaaggccaatcggatccgtcagatcaccgcgaagaagacccgcgaatctctgcaggcc
acagcacagttgacgcagacgcacgaggtcgacatgaccaagatcgtggcgctgcgggca
cgcgcgaagaatgacttcgccgaacgcgagggcgtcaacctgacgtatctgccgttcatc
gcccgggcggtgatcgacgcgctgaagacgcatccgaacgtcaacgcgagctacgacgaa
gagtccaaggagatcacctactacgacgccgagcatctcgggttcgccgtcgacaccgaa
cagggtctgctctcaccggtggtcaagaacgccggtgacctgtcgctggccgggctggca
cgcgcgatcgccgacatcgccgagcgcgctcgctcgggcgacctcaagcccgacgagttg
tccggcggcacgttcaccatcacgaacatcggtagtcagggcgcactcttcgacaccccg
atcctggtcccgccgcaggcggcgatgctcggtaccggcgcgatcgtgaagcggccgcgg
gtgatcgtcgactccttgggcaacgagtcgatcggcgtgcgctcggtctgctacctgccg
ctgacctacgatcaccggctgatcgacggcgcggacgccggacgcttcgtgaccaccatc
aagcgccgcctcgaagagggcgcattcgaggccgatctaagcctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system