KEGG   Mycobacterium rhodesiae: MycrhN_4693Help
Entry
MycrhN_4693       CDS       T01685                                 

Definition
putative O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MycrhN_4693
Enzymes [BR:mrh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MycrhN_4693
Exosome [BR:mrh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MycrhN_4693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4713777..4714529)
Genome map
AA seq 250 aa AA seqDB search
MSLKRRIPFLRWSFWRLAIGSRNITKTGQIGDGREAAAADYVVANARRGDIDDVIAKIDD
FAYDKSFLINIGDEKGELLDAAVRRAHTELALELGTYCGYGSLRIARAAPTATVFSVELS
EANARVAQRIWAHAGVADRVTCVVGTIGDGGKTLDALANEHGFSAGKLDLLFIDHDKAAY
LPDLQSILERGWLHPGGIVVADNMLIPGSPKYREYMREQQGKLFDTAEHKTHGEYQTLAP
DLVLESEYLG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgaagcgccgcatcccgttcctgcgctggtcgttctggcggctggccatcgga
tcccgcaacatcaccaagaccggccagatcggtgacggacgcgaagccgccgccgcggac
tacgtggtggccaatgcccgccggggcgacatcgacgacgtgatcgccaagatcgacgat
ttcgcctacgacaagtcgtttctgatcaacatcggggacgagaaaggcgaactgctcgac
gccgctgtgcgccgcgcccacaccgaactggcactggagttggggacctactgtggctac
ggctcgctgcggatcgcccgtgcagcacccaccgccacggtgttctccgtcgagctgtct
gaggcgaatgctcgagtcgcacagcgcatctgggcgcacgccggagtagccgaccgggtg
acgtgtgtcgtcggcacgatcggtgacggcgggaagacactcgacgcgctggccaacgag
cacggcttctccgccggaaagctcgacctgctgttcatcgaccacgacaaagccgcctac
ctgcccgacctgcaatccatcctggagcgcggctggctgcatcccggagggatcgtcgtc
gccgacaacatgctcattcccggctcccccaagtaccgcgaatacatgcgcgagcagcag
ggcaagctcttcgacaccgccgagcacaaaacgcacggcgagtatcagacgctggcaccc
gacctcgtgctcgagtcggaatacctgggctag

  All links  
No link information was found.   
DBGET integrated database retrieval system