KEGG   Mycobacterium rhodesiae: MycrhN_4823Help
Entry
MycrhN_4823       CDS       T01685                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_4823
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MycrhN_4823
   00630 Glyoxylate and dicarboxylate metabolism
    MycrhN_4823
Enzymes [BR:mrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MycrhN_4823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4883192..4885387)
Genome map
AA seq 731 aa AA seqDB search
MTERVEAGNLRVAQVLYDFVNNEALPGTGLDPDTFWSGVDKVVADLTPKNQELLAKRDDL
QARIDRWHRQRVIEPIDAEAYRQFLTEIGYLLPEPDDFTITTAGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISEDDGAEKGTSYNRVRGDKVIAYARRFLDGAA
PLATGAWNDATGIKIDDGQLVVTLGDGQSTGLKTPEQFVGYTGELGSPSWSVLLRNHGLH
IEILIDPDSPVGATDPAGIKDVVLESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNRGD
LSEEVAKGGKSFTRVLNDDRAYTTPDGEGELTLPGRSLLFVRNVGHLMTNDAIVDSEGNE
IPEGIQDALFTSLIAIHGLKADDDNGPKVNSRTGSIYIVKPKMHGPEEVAFTVELFSRVE
DVLGLPPNTIKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPM
IRKGAMKKQPWILAYEDQNVDVGLATGFSGRAQIGKGMWAMTDLMADMVEQKIGQPKAGA
TTAWVPSPTAATLHAMHYHEVDVYAVQKELEGKTRTTVEELLTIPLAKELAWAPEEIREE
VDNNCQSILGYVVRWIDAGVGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVITEDD
VKASLRRMAAVVDQQNEKDPEFRPMAPDPDASVAFTAAQELILAGAAQPSGYTEPILHRK
RREFKAANNGG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgcgtggaggcgggcaacctgcgtgttgcccaggtgctgtacgacttcgtc
aacaatgaggcacttcccggcaccggcctcgatcccgacaccttctggtcgggtgtggac
aaggtcgtcgcagatctgactccgaagaaccaggaactgctcgccaagcgcgacgatctg
caggcccgcatcgacaggtggcaccgtcaacgggtcatcgagccgatcgacgccgaggct
taccggcagtttctgaccgagatcgggtacctgctgcccgaacccgacgacttcaccatc
accacggctggcgtcgacgacgagatcaccacgaccgcgggtccgcagctcgtcgtcccc
atcctcaacgcgcgcttcgcgctcaacgccgcgaacgcacgctggggctccctgtatgac
gcgctctacggcaccgacgtcatctccgaggacgatggcgccgaaaagggcaccagctac
aaccgggtccgcggcgacaaggtcatcgcgtacgcgcgtcgcttcctcgacggcgccgct
ccgctcgccaccggcgcgtggaacgacgcgaccggcatcaagatcgacgatggacaactg
gtcgtcacgctgggcgacgggcagtccaccgggctgaagacaccggagcagttcgtcggc
tataccggcgaactcggctcgccgtcctggtcggtgctgctgcggaaccacggtctgcac
atcgagatcctgatcgaccccgactcccccgtcggcgccaccgatccagcaggaatcaag
gacgtcgtcctggagtccgcgatcaccacgatcatggacttcgaggactcggtggccgcc
gtcgacgccgacgacaaggtgctcggctaccgcaactggttgggcctgaaccgcggcgac
ctctccgaagaggtggccaagggcggcaagtccttcacccgtgtgctcaacgacgaccgt
gcctacaccacccctgacggtgagggcgagctgactcttcccggacgcagcctgctgttc
gtgcgcaacgtcggtcacctgatgaccaacgacgcgatcgtcgacagcgaaggcaacgag
attcccgagggcatccaggacgcgctgttcaccagcttgatcgcgatccacggcttgaag
gccgacgacgacaacggcccgaaggtcaacagccgcaccgggtcgatctacatcgtgaag
cccaagatgcatggacccgaagaggtcgcgttcaccgtcgagctgttcagccgcgtcgag
gacgtgctcggcctgccgccgaacaccatcaaggtcggcatcatggacgaggagcgacgg
accaccctgaacctcaaggcctgcatcaaggcggcagctgaccgggtggtgttcatcaac
accggcttcctggaccgcaccggcgacgagatccacacgtcgatggaggcgggtccgatg
atccgcaagggcgccatgaagaagcagccgtggatcctggcctacgaggatcagaacgtc
gacgtcggtttggcgaccgggttctccgggcgcgcgcagatcggcaaaggcatgtgggct
atgaccgatctgatggccgacatggtcgagcagaagatcggtcagcccaaggccggcgcc
acgacggcatgggtgccatcaccgacggcggcgacgctgcacgccatgcactatcacgag
gtcgacgtgtacgcggttcagaaggagctggagggcaagacccggaccacggtcgaggag
ttgctcaccatcccgttggccaaggaactcgcgtgggcgccggaagagatccgtgaagag
gtcgacaacaattgccagtcgatcctcggctacgtggtgcgttggatcgacgcaggcgtc
ggctgctctaaggtgcccgacatccacaacgtcgcgctgatggaagaccgtgccaccctg
cgtatctcgagccagctgctggcgaactggctgcgccacggtgtgatcaccgaggacgac
gtcaaagccagcctgcgtcgcatggccgcggtggtcgaccagcagaacgaaaaggatccc
gagttccggcccatggcgccggatccggacgccagcgtggcgttcaccgccgcgcaggaa
ctgatcctggccggcgccgcgcaaccgagcggctacaccgagccgatcctgcatcgcaag
cgtcgcgagttcaaggccgcaaacaacggtggttga

DBGET integrated database retrieval system