KEGG   Mycobacterium rhodesiae: MycrhN_4847Help
Entry
MycrhN_4847       CDS       T01685                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MycrhN_4847
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_4847
  Lipid metabolism
   00071 Fatty acid degradation
    MycrhN_4847
  Amino acid metabolism
   00350 Tyrosine metabolism
    MycrhN_4847
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MycrhN_4847
   00626 Naphthalene degradation
    MycrhN_4847
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MycrhN_4847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4906821..4907828
Genome map
AA seq 335 aa AA seqDB search
MRAWRVRRPGPMSTRPLEHVTADVPRPGPGELLVAVRACGVCRTDLHVAEGDLPVHRQGV
IPGHEVVGEVVEVGPQETPGAGFAVGDRVGIAWLRHTCGRCKFCESGKENLCAQSRYTGW
DADGGYAEFATVPAAYAHSLPDLYSDTELAPLLCAGIIGYRALLRAELPAGGRLGIYGFG
GSAHLTAQVALAQGAEVHVMTRGEKARDLASALGAASVQGAYDRPPVALDSAILFAPVGD
LVLPALEALDRGGTLAVAGIHLSDIPPMNYQRHLFQERQVRSVASNTRADAREFLSFAGR
HHLEVTSPQYPLARADDALADLGAGRISGAAVLVV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgtggcgggttcgtcggccaggtccgatgagcacccgtccactggagcacgtc
actgccgatgtgccgaggccgggaccgggcgagttactcgtcgcagtgcgggcatgtggc
gtgtgccgcaccgacctgcacgtcgcagagggtgatctgccggtgcaccggcaaggggtg
atcccgggtcacgaggtcgtcggcgaagtcgtcgaagtgggtccccaggaaacgccgggt
gctgggttcgcggtcggcgaccgggtcggaatcgcatggctccgacacacctgtgggcgg
tgcaagttctgcgagagcggcaaagaaaacctgtgcgcacagtctcgttacaccgggtgg
gacgccgacggcggatatgcggaattcgccactgtgccagccgcttacgcgcattcactg
ccggatctgtactccgacaccgagttggcgccattgctgtgcgccggcatcatcggctat
cgcgcgctgttgcgcgccgaactgcccgcgggcggacggctcggcatctacgggttcggc
ggaagtgcgcacttgaccgcgcaggtcgcgctcgcacagggggccgaggtccacgtgatg
acgcgcggggagaaagccagggacctggcgtcggcgctgggggcggcatcggtgcagggc
gcatatgaccgtccgccggtcgcactggactccgcgattctcttcgcacctgtcggtgat
ctggtgcttcccgccctggaggcgctcgaccgcggcggcacgttggccgtcgcggggatc
cacctgtccgacattccgccgatgaactatcagcgtcacctttttcaggagcgccaggtg
cggtcggtggcatccaacacccgagccgacgctcgcgaattcctctccttcgccggccgt
caccacctcgaggtgaccagtccgcagtacccgctcgcccgcgctgacgatgcactcgcc
gacctcggcgcgggccggatctccggcgcggcggtgctggtggtctag

DBGET integrated database retrieval system