KEGG   Mycobacterium rhodesiae: MycrhN_5206Help
Entry
MycrhN_5206       CDS       T01685                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MycrhN_5206
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MycrhN_5206
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MycrhN_5206
Enzymes [BR:mrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MycrhN_5206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5295166..5295954)
Genome map
AA seq 262 aa AA seqDB search
MSRLAEMFDTCRAENRAALIGYLPTGFPDIPISISAMTALVESGCDLVEVGIPYSDPGMD
GPTIAAATEVALRGGVRVRDTLTAVEAISNAGGRAVVMTYWNVVLHWGVDAFARDLATAG
GLGMITPDLIPDEASEWIEVAEAHNLDRIFLVAPSSTPERLASTVEASRGFVYAASTMGV
TGARDAVSTAAPELVSRVRAVSDIPVGVGLGVRSREQAAEIGAFADGVIVGSALVSALQD
GVDAVRTLTAELADGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggttggcggaaatgttcgacacctgccgggccgagaaccgtgcggcgctgatc
ggctacctgccgaccggttttcccgatataccgatctcgatttcggcgatgactgcgttg
gtcgaatccggctgcgacctcgtcgaggtgggcataccgtattcggaccccggtatggat
ggaccgacgatcgcggcggccacggaagtggcactccggggcggcgtgcgggtgcgtgac
acgttgacagccgtcgaggcgatcagcaacgcgggtggccgcgccgtggtcatgacgtac
tggaatgtggtgctgcactggggcgtcgacgcctttgcgcgcgacctggcaacggccggt
ggtctggggatgatcacgccggatctgatacccgacgaggcgtcggagtggatcgaggtc
gcggaggcccacaacctggatcgcatcttcctggtcgcgccgtcgtctaccccggaaagg
ctggcgtcgacggtcgaggcatcgcgcgggttcgtgtacgccgcatcgacaatgggcgtg
acgggcgcgcgagatgccgtgtcgacggccgcgccggaactggtcagccgggtcagggcg
gtgtccgacataccggtcggtgtgggactcggcgtgcgctcgcgtgagcaggccgctgag
atcggcgccttcgcggacggagtgattgtggggtcggctttggtgtcggcattgcaggac
ggagtggacgcggtgcgaacgctgaccgctgaactcgccgatggcgtgcgtcagaggatt
accgcgtga

DBGET integrated database retrieval system