KEGG   Mycobacterium rhodesiae: MycrhN_5206Help
Entry
MycrhN_5206       CDS       T01685                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mrh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mrh00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mrh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5295166..5295954)
Genome map
AA seq 262 aa AA seqDB search
MSRLAEMFDTCRAENRAALIGYLPTGFPDIPISISAMTALVESGCDLVEVGIPYSDPGMD
GPTIAAATEVALRGGVRVRDTLTAVEAISNAGGRAVVMTYWNVVLHWGVDAFARDLATAG
GLGMITPDLIPDEASEWIEVAEAHNLDRIFLVAPSSTPERLASTVEASRGFVYAASTMGV
TGARDAVSTAAPELVSRVRAVSDIPVGVGLGVRSREQAAEIGAFADGVIVGSALVSALQD
GVDAVRTLTAELADGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggttggcggaaatgttcgacacctgccgggccgagaaccgtgcggcgctgatc
ggctacctgccgaccggttttcccgatataccgatctcgatttcggcgatgactgcgttg
gtcgaatccggctgcgacctcgtcgaggtgggcataccgtattcggaccccggtatggat
ggaccgacgatcgcggcggccacggaagtggcactccggggcggcgtgcgggtgcgtgac
acgttgacagccgtcgaggcgatcagcaacgcgggtggccgcgccgtggtcatgacgtac
tggaatgtggtgctgcactggggcgtcgacgcctttgcgcgcgacctggcaacggccggt
ggtctggggatgatcacgccggatctgatacccgacgaggcgtcggagtggatcgaggtc
gcggaggcccacaacctggatcgcatcttcctggtcgcgccgtcgtctaccccggaaagg
ctggcgtcgacggtcgaggcatcgcgcgggttcgtgtacgccgcatcgacaatgggcgtg
acgggcgcgcgagatgccgtgtcgacggccgcgccggaactggtcagccgggtcagggcg
gtgtccgacataccggtcggtgtgggactcggcgtgcgctcgcgtgagcaggccgctgag
atcggcgccttcgcggacggagtgattgtggggtcggctttggtgtcggcattgcaggac
ggagtggacgcggtgcgaacgctgaccgctgaactcgccgatggcgtgcgtcagaggatt
accgcgtga

DBGET integrated database retrieval system