KEGG   Mycobacterium rhodesiae: MycrhN_5207Help
Entry
MycrhN_5207       CDS       T01685                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MycrhN_5207
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MycrhN_5207
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MycrhN_5207
Enzymes [BR:mrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MycrhN_5207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5295951..5297210)
Genome map
AA seq 419 aa AA seqDB search
MADLAGPELPRSSAAVAEPTIHDPDERGHFGAYGGRFVPEALMAVIEEVTAAYDKARGDQ
TFLDELDRLQRHYTGRPSPMYEASRLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKSRVIAETGAGQHGVATATACALLGLECIVYMGAVDTARQALNVARMRLLGAEVVS
VESGSKTLKDAINEAFRDWVTNADNTYYCFGTAAGPHPFPTMVRDFQRVIGLEARAQIQA
QAGRLPDAVTACVGGGSNAIGIFHAFIDDPGTRLIGYEAAGDGVETGRHAATFAGGTPGA
FQGSFSYLLQDDDGQTIESHSISAGLDYPGVGPEHAYLKDIGRAEYRPITDTEAMDAFGL
LCRTEGIIPAIESAHAVAGALKLGSELGRDAIIVVNLSGRGDKDVETAAKWFGLMDGDS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctagccgggccggagttgccgcgttccagtgcggccgtcgccgaacccacc
attcacgatcccgacgagcgtggccatttcggagcctacggcggacgattcgtgcccgag
gcgctcatggcggtgatcgaggaggtcaccgccgcctatgacaaagccaggggcgatcag
acatttctcgatgaactggaccgtctgcaacgccactacaccggtcgcccgtcaccgatg
tatgaggcatcgaggctttcagaacatgcgggcggagcacgaatcttcctgaaacgagaa
gaccttaaccacaccggatctcacaagatcaacaacgttctcgggcaggctctgctggcg
cggcagatgggcaagtcacgcgtcatcgccgagacgggtgcgggccagcatggtgtggcg
accgcgacggcgtgcgcgctgctgggcctggagtgcattgtctacatgggggcggtcgac
accgcgcgtcaggccttgaatgttgcgcggatgcgcctactcggtgcagaggtggtgtcc
gtcgagtccggctcgaagacgttgaaggacgcgatcaacgaagccttccgcgactgggtc
accaacgccgacaacacctactactgctttggtaccgccgctgggccccatccgtttccc
actatggtgcgcgacttccagcgagtgatcgggctcgaggcgcgcgcgcagatccaggcg
caagccggccgactgccggatgcggtgaccgcatgcgtaggtggcggatcgaacgcgatc
ggcatcttccacgctttcatcgatgatcccggcacccgcctcatcggctacgaagcagcg
ggcgatggcgttgaaactggccgtcacgcagcgactttcgcgggtggaactcctggggcg
ttccagggttcgttctcgtacctgcttcaggacgacgacgggcagacgattgaatcccat
tcgatctcagctggtttggactatcccggcgtcgggccggaacacgcgtacctgaaagac
atcggccgcgctgagtacaggccgatcaccgacaccgaggcgatggatgcgttcggattg
ttgtgccggaccgagggaatcatcccggccatcgaatcggcgcacgccgtagcgggtgcg
ctgaagctgggttccgagctcggccgtgacgcgatcatcgtggtcaatctgtcggggcgc
ggtgacaaggacgtcgagacagcggccaagtggttcgggttgatggacggtgactcgtga

DBGET integrated database retrieval system