KEGG   Mycobacterium rhodesiae: MycrhN_5321Help
Entry
MycrhN_5321       CDS       T01685                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:mrh01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mrh00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5410315..5411049
Genome map
AA seq 244 aa AA seqDB search
MSTVVEKYPDTDALVVGAGDRLVAAITGAIDKRGRALIVLTGGGTGTGLLKRVREQADGI
DWSKVHLYWGDDRFVPADDDERNEKQARQALIDHVDIPAANVHAMAPSGGEFGDDLDAAA
QAYEQVLAADADDGSIPDFDVHLLGMGGEGHINSLFPDTPAVKETSRTVIGVTDSPKPPP
RRITLTLPAVQRSREVWLVVSGEGKADAVAAAIGGANPVDVPAAGGVGREATVWLLDEAA
ASKL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtcgtcgagaagtacccggacacagacgctttggtggtcggtgccggagac
cggctcgtcgccgcgatcaccggggcgatcgacaagcgaggccgcgcactcatcgtgctc
accgggggcggcacagggaccgggctgctcaagcgggttcgcgaacaggccgacgggatc
gactggtcgaaggtccacttgtactggggcgacgatcgtttcgtgcctgctgacgacgac
gaacgcaacgagaaacaggcccgtcaggcgctgatcgaccacgtcgacatccctgcggcc
aatgtccatgccatggcgcccagtggcggcgagttcggagacgacctggacgcggccgcg
caagcgtacgagcaagtgcttgccgcggatgccgacgacggctcgataccggattttgac
gtccacctgctgggcatgggcggtgagggccacatcaactcgctgttcccggacacgccg
gccgtgaaggaaaccagccggacggtgatcggcgtgaccgactcccccaaaccgccgccg
cgacgaatcacgttgacgctgcccgctgtccagcggtcgcgcgaggtgtggttggtggtc
tccggtgagggcaaggccgacgcggtcgccgcggcgatcggaggcgccaaccctgtcgac
gtgcctgccgccggcggcgtcggtcgcgaagcgacggtgtggctactcgacgaggccgct
gcttccaagctctag

DBGET integrated database retrieval system