KEGG   Mycobacterium rhodesiae: MycrhN_5332Help
Entry
MycrhN_5332       CDS       T01685                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_5332
   01230 Biosynthesis of amino acids
    MycrhN_5332
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_5332
   00051 Fructose and mannose metabolism
    MycrhN_5332
   00562 Inositol phosphate metabolism
    MycrhN_5332
Enzymes [BR:mrh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MycrhN_5332
Exosome [BR:mrh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MycrhN_5332
  Exosomal proteins of bladder cancer cells
   MycrhN_5332
  Exosomal proteins of melanoma cells
   MycrhN_5332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5422156..5422941)
Genome map
AA seq 261 aa AA seqDB search
MSRTPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVAVLPPFTDLRSVQTLVDGD
KLRLTYGAQDVSQHESGAYTGEISGAFLAKLGCTYAVVGHSERRTYHHEDDALVAAKAAA
AFKHGITPIICIGEQLEVREAGNHVEYNVESLRGSVAGLTAEQIGEAVIAYEPVWAIGTG
RVASAADAQEVCKAIRDELGKLSSPQLAAGVRILYGGSVNAKNVGEIVAQEDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtaccccgctgatcgccggcaactggaagatgaacctcaaccacttcgaggcg
atcgcgttggtccagaagatcgcgttctctcttccggacaagtacttcgacaaggtcgat
gtcgcggtgctgccgcccttcaccgacctgcgcagtgtgcagacgctggtcgacggcgac
aagctgcggctcacgtatggggcgcaggacgtctcccagcacgagtcgggcgcctacacc
ggcgagatcagcggcgccttcctcgccaagctgggctgtacgtacgccgttgtggggcac
tcggagcggcgcacctaccaccacgaggacgacgccctggtggccgccaaggcggcggcc
gccttcaagcacggcatcaccccgatcatctgcatcggtgagcagctcgaggtccgcgag
gcgggcaaccacgtcgaatacaacgtcgagtcgctgcgcggctcggtggcgggactgacg
gccgagcagatcggcgaggccgtgatcgcctacgagccggtgtgggcgatcggtaccggt
cgggtggccagcgccgcagatgcgcaggaggtgtgcaaggccattcgcgacgagctgggc
aagctgtcgtccccgcagctcgccgccggtgtccgcattctgtacggcggctcggtgaat
gcgaagaacgtcggcgagatcgtcgcgcaggaggatgtcgacggtgcactcgtcggcggt
gcgtcgctggatggcgagcagttcgccaccctgtcggccatcgccgctggtgggccgttg
ccgtag

DBGET integrated database retrieval system