KEGG   Mycobacterium rhodesiae: MycrhN_5370Help
Entry
MycrhN_5370       CDS       T01685                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mrh00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5463043..5463639)
Genome map
AA seq 198 aa AA seqDB search
MSAGRGAGRVIVLSGPSAVGKSTVVRCLRDRVPDLFFSVSVTTRAPRPGEVDGVDYSFVT
ADRFQELIDHGALLEWAEIHGGLHRSGTPAQPVLDAARAGRPVLIEVDLAGARAVKQSMP
EVVSVFLAPPSWDALESRLTGRGTETQQVMDRRLATAREELAAQNEFDVVVVNSELESAC
SELVSLLVAHGEPPEFHR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgccggccggggggccggacgggtgatcgtgctgtccggcccctctgccgtcggg
aaatcgactgttgtccgctgtctgcgtgaccgcgttcccgacctgttcttcagcgtgtcc
gtcaccacccgggccccgcgtccgggcgaggtcgacggcgtcgactattcgttcgtcacc
gccgatcggtttcaggagctgatcgatcacggcgccctgctggagtgggcggaaatccac
ggtggcctgcaccgttcgggcacccccgcgcagccggtcctcgacgccgcccgcgctggt
cggcctgttctcatcgaggtggacctggccggggcccgcgccgtcaagcagtccatgccc
gaggtggtctcggtgttcctcgcaccgcccagctgggacgcattggagagccggttgacc
gggcgcggcaccgaaacccaacaggtgatggaccgccgcctcgccacagcgcgcgaggaa
ctggcagctcagaatgagttcgacgtcgtggtcgtgaacagcgaattggagtctgcctgc
tccgaattggtatccttgctggtggcccatggtgagccacccgaatttcacagataa

DBGET integrated database retrieval system