KEGG   Mycobacterium rhodesiae: MycrhN_5462Help
Entry
MycrhN_5462       CDS       T01685                                 

Definition
RelA/SpoT family (p)ppGpp synthetase
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MycrhN_5462
Enzymes [BR:mrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     MycrhN_5462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5549562..5551928)
Genome map
AA seq 788 aa AA seqDB search
MAEDPGTGQAVQSPPSAQMPETQPLEIPKTDSSKAATSASRRVRARLARRMTAQRSLVNP
VLEPLVAVHKQFYPKANLTLLQRAYEVAEERHAGQLRRSGDPYITHPLAVANILAELEMD
TTTLIAALLHDTVEDTGYTLEALTEEFGTEVGHLVDGVTKLDKVALGTAAEGETIRKMIL
AMARDPRVLVIKVADRLHNMRTMRFLPPEKQAAKSRETLEVIAPLAHRLGMATVKWELED
LSFAILHPKKYEEIVRLVADRAPSRDIYLAKVRAEITATLNASKINAVVEGRPKHYWSIY
QKMIVKGRDFDDIHDLVGVRILCDDVRDCYAAVGVVHSLWQPIAGRFKDYIAQPRFGVYQ
SLHTTVVGPEGKPLEVQIRTVDMHKTAEYGIAAHWRYKEAKGRNGAPANHAAAEIDDMAW
MRQLLDWQREAADPGEFLESLRYDLAVQEIFVFTPKGDLITLPTGSTPVDFAYAVHTEVG
HRCIGSRVNGRLVALERKLENGDQVEVFTSKAPNAGPSRDWQTFVVSPRAKAKIRQWFAK
ERREEALESGKDAIAREVRRAGIPLQRLMNAEQVAALARELRYVDVSALYTAVGEGHVSA
RHVVQRLVAQLGGDEDATDEIAERATPSTMPVRQRHTDDVGVAVPGAPGVLSKLAKCCTP
VPGDIIMGFVTRGGGVSVHRTDCTNAASLQEQSERIIDVQWAPSPSSVFLVAIQVEALDR
HRLLSDVTRVLADEKVNILSASVTTSDDRVAISRFTFEMGDPKHLGHLLNVVRNVEGVYD
VYRVTSAA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatcccggcacgggacaggccgtgcagtcgccgccgagcgctcagatgccg
gagacccagcccctggagatcccgaagacggattcatcaaaagcggcgacgagcgcgtcg
cgtcgggtgcgggcccggctggctcgccggatgacggcccaacgcagcctcgtcaacccg
gtgctggagccgctcgtcgcggtccacaaacagttctatcccaaggccaacctgacgctg
ttgcagcgcgcgtacgaggtcgccgaggagcgtcacgccggccaactgcgccgttccggt
gacccctacatcacccatccgctggccgtcgcgaacatattggccgagctcgagatggac
accacgacgctgatcgcggccctgctccatgacaccgtcgaggacaccggttacacgctc
gaggcgctgaccgaagagttcggcaccgaggtcggccacctcgtcgacggcgtcaccaaa
ctggacaaggtcgccttgggcaccgcggccgagggcgagaccatccgcaagatgatcctc
gcgatggcccgcgatccgcgggtgctggtcatcaaggtcgccgaccggttgcacaacatg
cgcaccatgcgtttcctgcccccggagaaacaggcggccaagtcccgcgaaacgctggaa
gtgattgcgccgctggcacatcgactcggtatggcgaccgtcaagtgggagctcgaggat
ctatcgttcgcgatcctgcatccgaagaagtacgaggagatcgtacggctggtcgccgac
cgggccccgtctcgcgacatctatctggccaaggtgcgcgccgagatcaccgcgacgctc
aacgcgtccaagatcaacgcggtggtcgagggcaggccgaagcactactggtcgatctac
cagaagatgatcgtcaagggccgcgacttcgacgacatccacgacctcgtcggggtgcgc
atcctttgcgacgacgtccgcgactgctatgcggctgtgggcgtggtgcattcgctctgg
cagccgatcgcgggccggttcaaggactacatcgcccagccgcgcttcggtgtgtatcag
tcattgcacaccaccgtcgtcggtcccgagggcaagccgctggaagtgcagatccgcacc
gtcgacatgcacaagaccgcggagtatggcatcgccgcgcactggcgctacaaggaagcc
aagggccgcaacggagcgccggcgaaccacgccgccgccgagatcgacgacatggcttgg
atgcgtcagcttctcgactggcagcgggaggccgccgaccccggagagttcctcgagtcg
ctgcgctacgaccttgcggtgcaggagatcttcgtgttcacgccgaagggcgatctgatc
acgttgcctacgggctcgactccggtggacttcgcctacgccgtgcacaccgaggtcggc
caccggtgtatcggctcacgcgtgaacggccggttggtcgcgttggagcgcaaactcgaa
aacggcgaccaggtagaggtgttcacttccaaggcgccgaacgcaggcccgtcgcgcgac
tggcagacgtttgtggtgtcgccgcgggcgaaggcgaagatccgccagtggtttgccaag
gagcgacgtgaagaggcgctcgaatcgggcaaggacgccatcgcccgtgaagtgcgacgc
gccggaattccgttgcagcggttgatgaatgccgaacaggttgccgcactcgcccgtgag
ttgcgctacgtggacgtgtctgcgctctacaccgccgtgggtgagggtcatgtgtcggcc
cggcacgtcgtgcagcgtctcgtcgcccaactcggcggcgacgaggacgccaccgacgaa
atcgccgagcgcgccacaccgtccaccatgccggtgcgtcaacgtcacaccgacgatgtc
ggcgtcgccgtgccgggtgcgccgggggtgctctccaagctcgccaaatgctgcactccg
gttcccggcgacatcatcatggggttcgtcacccgcggcggtggtgtcagcgtgcatcgg
accgactgcaccaatgcagcgtcgctgcaagaacagtcggagcggatcatcgacgtgcaa
tgggccccgtcgccgtcgtcggtgttcctggtcgccattcaggtcgaggcgctggaccgg
caccggttgctgtcggatgtgacccgcgtgctggccgacgagaaggtcaacatcctctcg
gcgtcggtgaccacgtccgacgaccgtgtggcgatcagcaggttcaccttcgagatgggg
gacccgaagcatctggggcacctgctcaacgtggtgcgcaacgtggagggcgtgtacgac
gtctaccgcgtcacctcggccgcctag

DBGET integrated database retrieval system