KEGG   Mycobacterium rhodesiae: MycrhN_5539Help
Entry
MycrhN_5539       CDS       T01685                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mrh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5624521..5625885)
Genome map
AA seq 454 aa AA seqDB search
MSASYSVVGGGISGLVAAYRLRVAAGPDASITVFDPADRLGGVLRTERIGGQPMDVGAEA
FVARRPEVPALLAELGLAGRQISTTGARPLIYSQGRLHALPSDTLQGIPAHAEALTGLVD
DATLAWIRDEPTRPFSWRPGADPSVAELVGHRFGDQVVARSVDPLLGGVYAGSSATIGVR
SALPPLAAALDRGARSLTDAVRDALAASAPSVTGSVFGAIDGGYAVLVDELVRRAGIRWL
QVAVERVDRGQQGWEIVDDEGMRHQADAAVLAVPAPRLARLVEGVAPRTAAAARRIGVAS
SALVALALPGGTPVPQQSGVLVAGGERLHAKAITLSTQKWGRRGNVELVRLSYGRFGDDL
ARNVGDEDLLAWAAQDLATVFDVAAEPEDYHVQRWIDAMPQYGPGHGELIADLRAGLPPT
LAVAGAYLDGIGVPACVGAATRAAASLVTSRVAR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcatcgtattccgttgtcggcggcggtatttcgggtctggttgccgcctaccgg
ctgcgcgtcgcggcggggccggacgcatcgatcacggtgttcgacccggccgatcggctc
ggcggagtgttgcggaccgagcgaatcggtggccagccgatggacgtcggcgccgaagcc
ttcgtcgcgcgccgtccggaggtgcccgcgctgctcgcggagttggggctggcgggcagg
cagatttccaccacgggcgcgcggccgttgatctacagccaggggcggctgcacgcgttg
ccctcggacacgctgcagggcattcctgcgcacgcggaggcgctgaccggactcgtggat
gacgcgacactcgcctggattcgcgacgagccgacccgccccttcagctggcgcccaggt
gccgacccttccgttgcggaactggtcgggcaccgcttcggcgatcaggtcgtggcccgg
tcggtcgatccactgctggggggcgtctacgcaggctcgtcagccaccatcggggtccgc
tctgcccttccgccgctggccgccgcactggaccgcggcgcgcgcagcctgaccgatgcg
gttcgtgacgcactggcggcgtcggcgccgtcggttaccgggtcggtgttcggcgcgatc
gacggcgggtacgcggtgctggtggacgagctcgtccggcgggcaggcatccgctggctg
caggtcgctgtcgagcgagtcgatcgtggacagcagggctgggagatcgtcgatgacgaa
ggcatgcgtcaccaggccgatgcggcggtccttgccgtacccgcaccgaggctcgcccgt
ctcgtcgagggagtcgcgccgcgcaccgcggcggcggcgcgacgcatcggggtcgcgtcg
agtgcgctggtggcattggcactgcccggcgggacgccggtgccgcagcaatccggagtg
ctggttgccggcggagaacggttgcacgccaaggcgataaccctgtcgacccagaagtgg
ggccgacgcggcaacgtcgagctggtgcgcttgtcttatggcagattcggtgacgatctg
gcacgcaatgtcggtgacgaagacctgttggcgtgggcggcgcaggatctggcgacggtg
ttcgatgtggcggcggaacccgaggactatcacgtccagcggtggatcgatgcgatgccg
cagtacgggccgggccacggcgaactgatcgccgacctgcgggccgggctgccgccgacg
ttggccgtcgccggcgcctatctggacggtatcggcgtccccgcgtgtgtgggcgcggcc
acacgggcggccgcgtcgctggtgacctcgcgcgtggcacgatag

DBGET integrated database retrieval system