KEGG   Mycobacterium rhodesiae: MycrhN_5539Help
Entry
MycrhN_5539       CDS       T01685                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MycrhN_5539
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MycrhN_5539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5624521..5625885)
Genome map
AA seq 454 aa AA seqDB search
MSASYSVVGGGISGLVAAYRLRVAAGPDASITVFDPADRLGGVLRTERIGGQPMDVGAEA
FVARRPEVPALLAELGLAGRQISTTGARPLIYSQGRLHALPSDTLQGIPAHAEALTGLVD
DATLAWIRDEPTRPFSWRPGADPSVAELVGHRFGDQVVARSVDPLLGGVYAGSSATIGVR
SALPPLAAALDRGARSLTDAVRDALAASAPSVTGSVFGAIDGGYAVLVDELVRRAGIRWL
QVAVERVDRGQQGWEIVDDEGMRHQADAAVLAVPAPRLARLVEGVAPRTAAAARRIGVAS
SALVALALPGGTPVPQQSGVLVAGGERLHAKAITLSTQKWGRRGNVELVRLSYGRFGDDL
ARNVGDEDLLAWAAQDLATVFDVAAEPEDYHVQRWIDAMPQYGPGHGELIADLRAGLPPT
LAVAGAYLDGIGVPACVGAATRAAASLVTSRVAR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcatcgtattccgttgtcggcggcggtatttcgggtctggttgccgcctaccgg
ctgcgcgtcgcggcggggccggacgcatcgatcacggtgttcgacccggccgatcggctc
ggcggagtgttgcggaccgagcgaatcggtggccagccgatggacgtcggcgccgaagcc
ttcgtcgcgcgccgtccggaggtgcccgcgctgctcgcggagttggggctggcgggcagg
cagatttccaccacgggcgcgcggccgttgatctacagccaggggcggctgcacgcgttg
ccctcggacacgctgcagggcattcctgcgcacgcggaggcgctgaccggactcgtggat
gacgcgacactcgcctggattcgcgacgagccgacccgccccttcagctggcgcccaggt
gccgacccttccgttgcggaactggtcgggcaccgcttcggcgatcaggtcgtggcccgg
tcggtcgatccactgctggggggcgtctacgcaggctcgtcagccaccatcggggtccgc
tctgcccttccgccgctggccgccgcactggaccgcggcgcgcgcagcctgaccgatgcg
gttcgtgacgcactggcggcgtcggcgccgtcggttaccgggtcggtgttcggcgcgatc
gacggcgggtacgcggtgctggtggacgagctcgtccggcgggcaggcatccgctggctg
caggtcgctgtcgagcgagtcgatcgtggacagcagggctgggagatcgtcgatgacgaa
ggcatgcgtcaccaggccgatgcggcggtccttgccgtacccgcaccgaggctcgcccgt
ctcgtcgagggagtcgcgccgcgcaccgcggcggcggcgcgacgcatcggggtcgcgtcg
agtgcgctggtggcattggcactgcccggcgggacgccggtgccgcagcaatccggagtg
ctggttgccggcggagaacggttgcacgccaaggcgataaccctgtcgacccagaagtgg
ggccgacgcggcaacgtcgagctggtgcgcttgtcttatggcagattcggtgacgatctg
gcacgcaatgtcggtgacgaagacctgttggcgtgggcggcgcaggatctggcgacggtg
ttcgatgtggcggcggaacccgaggactatcacgtccagcggtggatcgatgcgatgccg
cagtacgggccgggccacggcgaactgatcgccgacctgcgggccgggctgccgccgacg
ttggccgtcgccggcgcctatctggacggtatcggcgtccccgcgtgtgtgggcgcggcc
acacgggcggccgcgtcgctggtgacctcgcgcgtggcacgatag

  All links  
No link information was found.   
DBGET integrated database retrieval system