KEGG   Mycobacterium rhodesiae: MycrhN_5637Help
Entry
MycrhN_5637       CDS       T01685                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mrh  Mycobacterium rhodesiae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MycrhN_5637
   00670 One carbon pool by folate
    MycrhN_5637
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MycrhN_5637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5714989..5715474)
Genome map
AA seq 161 aa AA seqDB search
MTTVGLIWAQSSTGVIGRDGGIPWRLPEDQARFKELTMGRTVVMGRLTWESLPAKVRPLP
GRKNVVLTRQADYMADGAHVVPLLQDALTDDITWVIGGEQIYALALPLATRCEVTEVEID
LPRDDGDVVAPTLDETWIGTAGEWLTSSTGLRYRFFSYVRP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggtcgggctgatctgggcccagtcgagtacgggtgtcatcggccgcgacggc
ggcataccgtggcggctgccggaggaccaggcccgcttcaaggagctgacgatgggacgc
accgtcgtcatggggcggctgacctgggagtcgctgcccgcgaaggtgcggccgctgccc
ggccggaaaaatgtcgtactgacgcggcaagctgactacatggccgatggcgcgcacgtg
gttcccctgcttcaggacgccctgaccgacgacatcacctgggtgatcggcggtgaacag
atctatgcgctggcgctgccactggcgacgcggtgtgaggtcaccgaggtggagatcgat
ctgccccgcgacgacggcgacgtcgtggcgcccacgctggatgaaacctggataggcacc
gcgggggagtggctgacgagctccaccggtctgcgctatcggtttttcagctacgttcgc
ccgtga

DBGET integrated database retrieval system