KEGG   Mycobacterium rhodesiae: MycrhN_5685Help
Entry
MycrhN_5685       CDS       T01685                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MycrhN_5685
Enzymes [BR:mrh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MycrhN_5685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5760136..5761959)
Genome map
AA seq 607 aa AA seqDB search
MTTYPFNAIVGHDRLRLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAEVLAAVDGAAL
VELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDVLLD
AAAMGRVHVERDGVSHSHDARFVLVGTMNPEEGELRPQLLDRFGLTVDVHASRDVDVRVE
VVRQRMAFEADPAGFAQRYAAADAELVDRIAAARQKVAAVTLPDSELRRIAALCAAFDVD
GMRADLVVARTAVAHAAWRGDDTVTEDDVRVAAELALPHRRRRDPFDDPGLDPDQLDQAM
QQAGESADPDPEPDPPGGGESASDQTSEPAAPQRNSSSATRPSAPPSAVFRTRALVVPGV
GDGAPGRRSRARNRTGTVVSSTTHAAEGHGVHVFGTLLAAAGHQQAPGRPRPVLEDVRHA
VREGREGNLVIFVVDASGSMAARDRMSAVSGAALSLLRDAYQRRDKVAVITFRQSGARLL
LPPTSSVHIASRRLARFDTGGKTPLAQGLLAARDVVVREKARDRARRSLVVVLTDGRATG
GPDPLGRTREAAARLMAEGAAAVVVDCETSYVRLGLAEQLARQLGAPAVRLAQLRADSLT
DVVRTAA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgtaccccttcaacgcgatcgtcggccacgaccggctgcgcctggcgctgctg
ctgtgtgcggtgcgcccggagatcggcggcgtgctgatccgcggggagaagggcacggcg
aaatcgaccgcggtgcggggcctcgccgaggtgcttgccgcagtggacggcgcggccctg
gtcgagctgccgatcggcgcgaccgaggatcgcgtcgtcggttcactggacctgcagaag
gtgctccgcgatggcgagcacgcgttctcgcccggcctgttggcccgcgcgcacggtggc
gtgctctatgtcgacgaagtcaatctgctacacgatcacctcgtggacgtgctgctggac
gcggccgcgatgggtcgggtgcacgtggagcgcgacggggtatcgcacagtcacgacgca
cgtttcgtcctcgtcgggacgatgaatcccgaagagggcgaactgcgtccgcagttgctc
gaccggttcgggttgaccgtcgacgtgcacgcctctcgcgatgtcgacgtccgtgtcgag
gtcgttcggcagcggatggcgttcgaggccgacccggcggggttcgcgcaacggtacgcc
gcagccgacgccgaattggtcgaccgcatcgccgcggctcgccagaaagtggcggcggtg
acgttgccggacagcgagttacgtcggatcgccgccctgtgcgcggcattcgacgtcgac
ggtatgcgcgccgatttggtggtcgcgcggactgcggttgctcacgcggcctggcgcggc
gatgacacggtcaccgaggacgatgtccgggtggccgccgaactcgcgctgccgcaccgg
cgacggcgcgacccgttcgacgatcccggactcgaccccgaccagctcgaccaggcgatg
caacaggcgggggagtccgcggaccccgacccggagcccgacccgcccggtggtggagaa
tcggcatcggatcagacgtctgaacctgctgccccgcagcggaattcgagctcggcgacc
cgtcccagcgcgccaccgtcggcggtgttccggacccgcgcactcgtcgtacccggcgtg
ggagatggcgcgcccgggcgcagatcacgcgcgcgcaaccgcaccggaaccgtggtctcg
tccaccacgcacgccgccgagggccacggcgtgcacgtgttcgggacgctgctggccgcg
gccggacaccaacaggcgccgggacgaccccggccggtgctcgaggacgtgcggcacgcc
gttcgcgaagggcgcgaagggaatctggtgatcttcgtggtcgacgcgtcgggctcgatg
gccgcccgcgaccgcatgtcggcggtcagcggtgcggcgttgtcgttgttgcgcgacgcg
taccagcgccgggacaaggtcgccgtgatcacgttccggcaatccggtgcccggttactg
ctgccgccgacgtcctcggtgcacatcgcgagccgtcggctcgcacgcttcgacaccggc
ggcaaaacgcccctggcgcaaggtctgctggccgcccgcgacgtggtcgtccgggagaag
gcgcgtgaccgtgcccggcgcagcctggtcgtggtgctgacggacggtcgcgcgaccggc
ggccccgatccgttggggcgcaccagggaggcggcggctcggctgatggccgaaggtgcg
gccgctgtcgtggtggactgcgaaacctcctacgtacgattgggtttggcggagcaattg
gcccgtcagctgggtgcgccggctgtgcgtctggcgcagcttcgcgctgacagcctcacc
gacgtggtgcgcaccgccgcctga

DBGET integrated database retrieval system