KEGG   Mycobacterium rhodesiae: MycrhN_5702Help
Entry
MycrhN_5702       CDS       T01685                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MycrhN_5702
Enzymes [BR:mrh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MycrhN_5702
Peptidases [BR:mrh01002]
 Cysteine Peptidases
  Family C44
   MycrhN_5702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5781144..5782943
Genome map
AA seq 599 aa AA seqDB search
MCGATGEVRLDGLPPDIAAVSAMAEAMTPRGPDGAGVWSQGRVALGHRRLKIIDLTEAGA
QPMVDSDLGLSIAWNGCIYNYKELRQDLSGRGYRFFSTSDTEVLLKAYHHWGDRFVDHLK
GMFAFAIVERDSGRVLLGRDRLGIKPLYLAEDAKRIRFASSLPALIAGGGVDTRIDPVAL
NHYLSFHSVVPPPRTILRGVSKVPPAALVAIEPDGRRVTTRYWEPDFTRRAETAAWSEKD
WEDAVLESLRLAVKRRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLATFSIGFESVGG
VKGDEFKYSDIVAQRFGTDHHQIRIDTARMLPALDGAIGAMSEPMVSHDCVAFYLLSQEV
AKHVKVVQSGQGADEVFAGYHWYPPMADAASLDDAVARYRAAFFDRDPSGVAALVNADYL
AESDPSLEFVTEHFANPGADGGIDRALRLDTTVMLVDDPVKRVDNMTMAWGLEGRVPFLD
HELVELAATCPPELKIAHDGKGVLKQAARRVIPSEVIDRPKGYFPVPALTHLEGPYLEMV
RDALYAPVAKERGLFRPDAVEQLLADPNGRLTPLRGNELWQLALLELWLQRHGINGTAA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggagccaccggcgaggtgcgcctcgacggattaccccctgacatagcggcggtc
tcggccatggccgaggcgatgacaccgagaggccccgacggcgcgggcgtctggtcgcag
ggccgcgtcgcgctgggtcatcgtcgcctgaagatcatcgacctgaccgaggcgggcgcc
cagccgatggtcgactccgacctcgggttgtcgatcgcctggaacggctgcatctacaac
tacaaggaactgcgccaggacctgagcggccgcggctatcgcttcttctccaccagcgac
accgaagtcctgctcaaggcctaccatcactggggcgaccgattcgtcgaccacctcaag
ggcatgttcgccttcgcgatcgtggagcgggacagcggccgggtgctattgggccgtgac
cggctgggaatcaagccgctgtatctcgcggaggacgcgaaacgcatccggttcgcgtcc
tcgctgcccgcgctgatcgccggtggcggcgtggacacccgtatcgatcccgtcgcgctc
aaccattacctgtccttccactccgtggtcccgccgccgcgcacgatcctgcgcggcgtg
tccaaggtgccccccgcggccctcgtcgcgatcgagccggacggacgccgcgtgaccacc
cggtactgggaacccgatttcacgcggcgggcagaaacggccgcctggtccgaaaaggac
tgggaggacgcggttctcgaatcgctgcgcctggccgtcaagcgccggctggtcgccgac
gtgccggtgggctgcctgctctccggtggcgtcgactccagcctcatcgtcgggctgctc
gccgaagcgggccagcacgggctggcgaccttctccatcggcttcgagtccgtgggcggc
gtgaagggcgacgagttcaagtactccgacatcgtcgcccagcgcttcggcaccgaccac
catcagatccgcatcgacaccgcccggatgctgcccgcactcgacggtgctatcggcgcg
atgagcgaaccgatggtcagccatgactgcgtggctttctacctgctcagccaggaggtg
gccaagcacgtcaaggtcgtgcagtccggtcagggcgcagacgaggtgttcgccggctat
cactggtatccgccgatggccgacgcggcatcgctggacgacgcggtggccaggtaccgc
gcggcgttcttcgaccgcgaccccagcggagtcgccgcgctcgtcaatgcggactatctc
gcggaaagcgatccgagcctggagttcgtcaccgagcacttcgcgaatccgggggccgac
ggcgggatcgaccgcgcgctgcggctcgacaccacggtcatgctggtcgacgacccggtg
aagcgcgtcgacaacatgacgatggcctggggtctcgagggccgggtaccgttcctcgac
cacgagctcgtcgagctggcggctacctgcccgcccgagctgaagatcgcgcatgacggc
aagggagtgctcaagcaggccgcccgccgggtgatcccgtcggaagtcatcgaccgcccc
aagggctacttccccgtccccgccctgacgcacctcgaggggccctacctggagatggtc
cgcgacgccctctacgcacccgtggccaaggaacgcgggctgttccgccccgacgccgtc
gagcagctgcttgccgacccgaacgggcggctgaccccgctacgcggcaacgagctgtgg
cagcttgcgctgctcgagttgtggctgcagcgccacggaatcaacgggacggcagcgtga

DBGET integrated database retrieval system