KEGG   Mycobacterium rhodesiae: MycrhN_5773Help
Entry
MycrhN_5773       CDS       T01685                                 

Definition
arginase family hydrolase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
mrh  Mycobacterium rhodesiae
Brite
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     MycrhN_5773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5849648..5850625
Genome map
AA seq 325 aa AA seqDB search
MSFTPTADEAIHLLEGYFYWSGFPKLLGCEIETDFAKADIALVGLPLAVNPVERTQYLGP
RAVRHRSQAYHRGHREFGINPFELARIRDFGDVPIPTPTIADQAVLDIEKFYARMDAAGV
LPFTIGGDHACTLPVLRAIAGPNSRRKAPIGIIHFDSHTDTYGDSAGVRCHAGNGFRIGN
EEGLIDPSRYVLVGLNGPMVHPNMDDYSKDAGYRLLSLEEIEDIGIPAAVGEIQKVIGDG
PVYVTVDLDVLTLSDAPAVADPEAGGLTMREMQKILRSFRGMDVIGGDVVCFVPHLDPSQ
ITALHISAIMHEIVTVMAEGVAKKR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagctttactcctaccgctgatgaggccatccacctgctcgaaggatacttctactgg
agcggatttccgaagttgctgggatgtgaaatcgagacagatttcgcaaaggccgacatc
gcattggtaggactcccgctggcggtcaatccagtcgagcggacgcagtatctgggcccc
cgcgcggtcaggcaccgctcacaggcgtatcaccgcggccaccgcgagttcggcatcaac
cccttcgagctggccaggatccgtgatttcggggacgtgccgattcccacaccgaccatc
gccgatcaagccgtcctcgacatcgagaagttctatgcacgcatggacgccgcgggagtc
ctcccatttaccatcggcggcgaccacgcctgcacgctgccggtgctgcgggccatcgcc
gggccgaactcgcgtcgcaaagcaccgatcgggatcatccatttcgactcgcacaccgat
acatacggcgattcggcgggcgtgcgttgccatgccggcaacggcttccggatcggcaat
gaagaagggttgatcgacccgtcacgctacgtactcgtcggcctcaacggtccgatggtg
catccgaacatggacgactactccaaggacgccggataccggctgctgtccctcgaagag
atcgaggacatcgggatacccgcggcggtcggcgagattcagaaggtgatcggcgatgga
ccggtctacgtgacagtggatttggatgtgctgacgctcagcgatgcacctgccgtcgcc
gacccggaggccggcggactgaccatgcgtgaaatgcagaagatcctgcgcagcttccgc
gggatggacgtcatcggcggcgacgtggtgtgcttcgtgccccatctcgatccgtcgcag
atcacggccttgcacatcagcgcgatcatgcacgagatcgtgacggtcatggccgagggc
gtggcgaagaagcggtag

DBGET integrated database retrieval system