KEGG   Mycobacterium rhodesiae: MycrhN_5934Help
Entry
MycrhN_5934       CDS       T01685                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_5934
   01230 Biosynthesis of amino acids
    MycrhN_5934
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_5934
   00030 Pentose phosphate pathway
    MycrhN_5934
   00051 Fructose and mannose metabolism
    MycrhN_5934
   00052 Galactose metabolism
    MycrhN_5934
  Energy metabolism
   00680 Methane metabolism
    MycrhN_5934
Enzymes [BR:mrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MycrhN_5934
Protein phosphatases and associated proteins [BR:mrh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MycrhN_5934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6007931..6008962)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDVRYGSKVVGFLDGWRGLLEDRRIQLANDDRNDR
LLAKGGTMLGTARVHPDKLRAGLDQIKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALGVAAEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPYDVEEVCRLIKQRFVRGDAHFICVVAEGAKPAEGTTQLRPGGID
EFGHEKFTGVAQQLAVEVEKRINKEVRVTVLGHVQRGGTPTPYDRILATRFGVNAADAAH
AGEYGMMVSLRGQEIGRVPLADAVRQLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagtactcactggcggaggcgactgtcccggcctgaatgcggtgatccgc
gccgtcgtccgcacatgcgacgtgcgctacggatccaaggtggtcggttttctggacggg
tggcgcggcctcctcgaggaccggcggatccagctggccaacgacgatcgcaacgatcgg
ttgctggccaagggcggcacgatgctgggcaccgcccgggtgcatcccgacaaactgcgg
gccgggctcgatcagatcaagcagacgctcgacgacaacggcatcgatgtgctgatcccg
atcggcggcgagggcacgctgaccgcggcccactggctctccgaggagaacgtgccggtg
gtgggtgtacccaagaccatcgacaacgacatcgactgcacggatgtgaccttcggacat
gacaccgcgctgggtgtcgccgccgaggcaatcgatcgcctgcacagcaccgccgagtcg
catcagcgcgtgatgctggtcgaggtgatgggccgccacgccggctggatcgcgttgaac
gccggcctcgcgtccggtgcgcatatgacattgatccccgaacagccctatgacgtcgaa
gaagtgtgccggctgatcaagcagcggttcgtccgcggcgacgcccatttcatctgcgtg
gtggccgaaggcgccaagccggcggaaggtacgacgcagttgcgcccaggcggcatcgac
gaattcgggcacgagaagttcacgggcgtcgcacaacagctcgcggtcgaagtcgagaag
cggatcaacaaagaggtgcgcgtcaccgtcctcggacacgttcagcgtggcgggacgccg
acgccctacgaccggatcctcgccacccgcttcggggtgaacgccgctgacgccgcgcac
gcgggtgaatacgggatgatggtgtcgctgcgaggtcaggagatcggccgggtgccgctc
gccgacgcggtgcgccagctcaagctcgtgccgcagagtcgctacgacgacgccgccgaa
ttcttcggctga

DBGET integrated database retrieval system