KEGG   Mycobacterium rhodesiae: MycrhN_6104Help
Entry
MycrhN_6104       CDS       T01685                                 

Definition
cellobiohydrolase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MycrhN_6104
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MycrhN_6104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6181950..6182942
Genome map
AA seq 330 aa AA seqDB search
MISSAAHAVARLLVLAVAAIAGIGLLADPVGQTSAVRLASDANPLLGAPFYVNPGSAAMR
AANAAEPPNPQLRAVADTPQAYWLVPGSSAATVGKYTADAAAAGSIPVLSIYGIPHRDCG
SFAAGGMASGDAYRGWIDGIAAQIGGSRAAIVLEPDALAMADCLSDDQRQERYDLIRYAV
DALTRNPAAAVYVDAGHLRWHSPEEMASRLSQAGVEHARGFSLNVANFFTTEEEIGYGEA
ISGLTNGKNYVIDTSRNGNGAAPDSPLHWCNPSGRALGVAPTTATAGAHADAYLWIKRPG
ESDGSCDKGDPPAGTFVNQYVIELASNAGR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcctcagctgcccacgcagtcgcgcggttgctcgtcctcgcggtcgccgccatt
gccggcatcggtttgctcgctgatcccgtcggccagacctccgcggtgcgcctggcaagc
gatgcgaacccactgcttggtgccccgttctacgtcaatccgggctcggcggccatgcgt
gcggcgaatgcggcagagccgccgaacccccagctgagagccgtcgctgatacgccccag
gcgtattggctggttccgggatcgtcggcagccacggtcgggaagtacacggctgacgcc
gcggctgccggctccatcccggttctgtcgatctacggaattccgcatcgcgactgcggc
agcttcgccgcgggcggcatggcgtcaggtgatgcgtatcgcggatggatcgacggcatc
gctgcccaaatcggaggttcgcgggccgcgatcgtcctcgagcccgatgcgctcgccatg
gcggactgcctgtccgacgatcagcgccaggaacgctatgacttgatccgttacgcggtc
gacgcgctgacgcgtaatccggccgcggccgtgtacgtcgacgcgggtcacctgcgttgg
cacagcccggaagagatggcttcgcggctcagtcaggcaggtgtcgagcacgcgcgcggg
ttcagcctcaacgtcgcgaacttcttcaccacggaggaggagatcggttacggcgaagcg
atttccggactcacgaatggcaagaactacgtgatcgacacgtcgcgcaacggcaatgga
gcggcgcctgactcacccctgcactggtgcaatcccagcggccgagcactcggtgttgcg
ccgaccactgccacagcgggcgcacacgccgacgcctacctgtggatcaaacgtcccgga
gaatccgacggctcgtgcgacaagggtgatccgcccgccggcaccttcgtgaatcagtac
gtcatcgagctggccagtaacgccggccgatag

DBGET integrated database retrieval system