KEGG   Melioribacter roseus: MROS_0095Help
Entry
MROS_0095         CDS       T02176                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mro  Melioribacter roseus
Pathway
mro00051  Fructose and mannose metabolism
mro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mro00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MROS_0095
Enzymes [BR:mro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MROS_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II AAA_33
Motif
Other DBs
NCBI-ProteinID: AFN73339
UniProt: I6ZMU4
Position
complement(122179..122967)
Genome map
AA seq 262 aa AA seqDB search
MYNEWELRKHIVEVGKRIWTRGYVAANDGNITVLLNDDEVLTTPTGVSKGFMTTDMIIKC
DRQGNVITKNSKYRPSSELKMHLEVYRERPDVKSVVHAHPPYATSFAVAGIPLDKCVLPE
AIIVIGAVPIAPYGLPSTSEIPDNIRPYIKNSDAILLENHGALTLGSDLFNAYYKMETLE
HTASIVWKAIQLGNLNVLSPEERDRLLGLREKFNLPGRVTVCSTDANSAAQNKDPQPQKL
NESMIQDIVEQVLTNLKSKLTK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtataacgaatgggaactgcgaaaacacattgtggaggtcggaaaaagaatttggacg
cggggatacgtagcggcaaacgacggcaacataaccgtcttattaaacgacgacgaggtt
ttgacaactcccaccggcgtcagtaaaggtttcatgacgaccgacatgataatcaaatgc
gacaggcagggcaacgtaatcacgaaaaattcaaaataccgtccttcgagcgagttgaaa
atgcatcttgaagtttatagggaacgtccggatgtaaaatccgtagttcatgcgcatcca
ccgtatgctaccagttttgcagttgcaggcataccgcttgacaaatgcgtattgcccgaa
gcaataattgtaatcggagctgtgccgattgctccttacggtctgccttctacgtccgaa
attcccgacaatatccgtccctatataaaaaattcggatgcaattctgctcgaaaatcac
ggcgcgcttacgcttggcagcgatctattcaatgcttattacaaaatggaaactctcgaa
catactgccagcattgtctggaaagccattcaattgggcaacctgaatgtcttgtcgccc
gaggaacgcgaccgtctgctcggtttgagggaaaaattcaatctgcccggtagagttacc
gtctgcagtacggacgcaaattctgccgctcagaataaagatcctcaacctcaaaaatta
aatgaaagtatgatacaggatattgttgaacaggtgctgactaacttaaaaagtaaacta
acaaaataa

DBGET integrated database retrieval system