KEGG   Melioribacter roseus: MROS_0117Help
Entry
MROS_0117         CDS       T02176                                 

Definition
glycosyl hydrolase, family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
mro  Melioribacter roseus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mro00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MROS_0117
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MROS_0117
Enzymes [BR:mro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MROS_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148353..149849)
Genome map
AA seq 498 aa AA seqDB search
MKRTNLLFVLLIIIAAACARDGYEYSEAVVVQTSKSGDKLSEKGLFNLSSQGYNSDILIK
LEPDTLYQKIVGFGGAFTESSAYVLNQISPEKRTEVLNAYFSKSGADYSLMRTHINSCDF
SLKNYSYADVPGDTALKYFTVKEDLDDLVPLIKDARKISAEGFKLLASPWTAPPWMKDNN
DWNGGSLKPEYYPVWAKFFVKYIEAYDSLGIDIWGVTVENEPLGNDENWESMIYTPEQMA
DFVKNHLGPTFQKEGIDANILIYDQNRDEVVEWAEKILGDPDAAKYVWGTAVHWYSSTIS
WYPEALNEVHKKFPDKHLMHTEGCIDSEVPVWKDDLWYWSKEATDWGYDWASPETKHLHP
KYVPVFRYARDIIGGLNSWLTGWIDWNIVLDDKGGPNHAQNWCIAPVIVKPEEDEVYYTP
LYYVMSHFSKYIRPGAHRIKLDINNSGIMATAAINEDISIAVELFNPTEKEFTYSVEIAG
KYINYNLPGNSLQTIIIK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggacaaatttattattcgtattgctgataattattgccgcggcatgcgcccgc
gatgggtatgaatactctgaagcggttgtagtccagacttcgaaatctggcgataaactg
tcagagaagggacttttcaatttaagctctcaggggtataactccgatatcctaattaag
cttgaaccggacacgctttatcaaaaaattgtcggattcggaggcgcgtttactgaatct
tcggcttatgttctaaatcaaatcagtcccgaaaaaagaacagaggtattgaacgcatat
ttctcaaaatcgggcgctgattattcattgatgagaactcatattaacagttgcgatttt
tcgctgaaaaattattcatatgccgatgtgcccggcgatacggctctgaaatattttacc
gtcaaagaggatttggacgatttagttccgctgattaaagatgcccggaaaatctctgcg
gaaggtttcaagctgttagcgtcaccctggacggctccgccgtggatgaaagacaataac
gattggaacggaggatctttaaaaccggaatactatccggtctgggctaaattctttgta
aaatatattgaagcttatgacagtctgggaatcgatatttggggagtgacagtcgaaaac
gagccgctggggaacgatgaaaattgggaaagcatgatttatactcccgaacaaatggct
gatttcgttaagaatcatttgggaccgactttccaaaaagaaggcatcgacgctaatatt
ttgatttacgaccagaacagggacgaagttgtagagtgggcggaaaaaattctcggcgat
cccgacgcggcaaaatacgtatggggaacggcggttcactggtacagcagtacaatttcg
tggtatcccgaagctttgaatgaagtgcacaaaaaatttcccgataaacacttaatgcac
accgaagggtgtatcgattcggaagtcccggtttggaaggacgacctctggtactggagc
aaagaggctaccgattggggttacgattgggcttcgccggaaaccaagcatctgcatcct
aaatacgtgcccgtattccgatatgcgcgtgatattatcggggggcttaacagttggctt
acaggatggatcgactggaatattgttctcgacgataaaggaggaccgaatcacgctcaa
aattggtgcattgcgcctgtaatcgttaaacctgaagaagacgaggtttattacactccg
ctctattacgtaatgtcgcatttcagcaagtatataagaccgggggctcataggattaaa
ctcgatattaacaattccggtattatggcgacagcggcaatcaacgaagacatatcgatt
gcagtcgaattatttaatccgactgaaaaagaatttacatactcggttgagattgcagga
aaatatattaattacaatctgcccgggaattcattgcaaacaattattataaaatga

DBGET integrated database retrieval system