KEGG   Melioribacter roseus: MROS_0401Help
Entry
MROS_0401         CDS       T02176                                 

Definition
(GenBank) Class II aldolase/adducin-like protein
Organism
mro  Melioribacter roseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
450590..451249
Genome map
AA seq 219 aa AA seqDB search
MKKIILLFLILIFGCTAQSDIEYKEYKDQLIETAKRCYDRQLFWGSGGDISVKIPGAGKF
IVKSTGYSLGSLDYDRVTTMTFDNEVIEGKTPSHEAPIHGNIYKIRKDVGAILHMHTPYS
TAWATAGMKVPPVTQQSVKLLSKCGIVKYHPVGSNELIEEITDLYKDTRIKVVFMENHGV
FVVGKDLEELLNNAELVENTARIAYLLKTIGTPKEFKFE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagataatattactctttctaattttaatattcggatgtacggcgcaatcggat
atcgaatataaggaatataaagaccaattgatcgaaacagccaaaaggtgctacgatcgc
cagcttttctggggctcgggaggcgatataagcgtaaagattcccggcgccggcaagttt
atcgtcaaatcgacaggctattcgctcggatctctcgattatgatagagttactacaatg
actttcgataatgaagtgattgaaggaaagacgccatcgcacgaggctcccatacacggc
aacatatataaaataagaaaagacgttggggctatacttcatatgcacactccttattcg
acggcatgggcgacagcgggcatgaaagttccgccagtaactcaacagtccgttaaattg
ctttcgaaatgcggaatagttaaataccatccggtcggctcaaatgaacttatcgaagaa
ataaccgatttatataaagacacaagaataaaagtagtttttatggagaatcacggcgta
tttgtagttggcaaagatctggaggaactgctcaataatgcggaacttgttgagaacacg
gctcgcatagcttatttattaaagacgattggcacacccaaagaattcaaattcgagtga

DBGET integrated database retrieval system