KEGG   Melioribacter roseus: MROS_0753Help
Entry
MROS_0753         CDS       T02176                                 

Definition
(GenBank) endoglucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
mro  Melioribacter roseus
Pathway
mro00500  Starch and sucrose metabolism
mro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MROS_0753
Enzymes [BR:mro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MROS_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-ProteinID: AFN73995
UniProt: I6Z4D9
Position
complement(868160..869203)
Genome map
AA seq 347 aa AA seqDB search
MSIKNILLLLTLISFSFFNCKDESQAVTNPAEDASPKTIVELIGPLKTAGNRIVGKADTA
VVLRGMSLFWSQWGGKYYNEECVKWLRDDWKCTIVRASIGVESGGYLSNPEAEMQKAETV
INAAINLGIYVIVDWHDHHAENHLEEAKEFFKAIAQKYGDKPNLIYEIYNEPMQVSWSKV
VKPYAVEVIKTIREYDPDNLIVVGNPTWSQDVDVAAKDPIDDVNVAYSLHFYSSTHRQYN
RTKASNALANGAALFVTEYGLSEASGNGNIDLNEANLWFDFMEQNKLSSCNWSVMDKNES
SAALKPGASATGGWNESDLTLSGNTIRNYIRSHNAPLFELLTKQSKR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaaaaatatccttcttcttttaacgctaatttccttttcctttttcaattgc
aaggatgaaagccaggcggttacgaatcctgctgaagatgcaagtccaaaaacaattgtt
gagttgatcggacctctgaaaacagccggaaacagaattgtcgggaaagcagacaccgcc
gtagtgctgagaggaatgagtttgttctggagtcaatggggcggtaaatactataatgaa
gagtgcgtcaaatggttaagagacgattggaagtgtacgattgtaagagcttctatcgga
gtcgaaagcggcggttatctttccaatcccgaagcggaaatgcaaaaagccgaaacggtt
ataaacgccgcgattaatctgggcatttatgtaattgtcgactggcacgaccatcacgcc
gaaaatcacctggaagaagccaaggaatttttcaaggcaatagctcaaaaatacggcgac
aaaccgaatctgatttacgaaatttacaacgagccgatgcaggtgtcgtggagcaaagtc
gtaaagccgtacgcagtggaagtgattaaaaccatcagagaatacgaccccgacaattta
atcgtcgtgggcaatcccacatggtctcaggacgtagacgtcgcggcaaaagacccgatt
gacgacgtaaacgtcgcttattcgctccatttttattccagcactcacaggcaatacaac
agaacaaaagcctcaaacgctctcgcaaacggcgcggctctatttgtaaccgaatacggt
ttgagcgaagccagcggcaacggcaatatcgatttgaacgaagcaaatctatggttcgac
tttatggaacaaaataaattgagcagttgcaactggtcggttatggataaaaacgaaagc
tcagcggctctgaagcccggtgcttctgctaccggcggatggaacgaatccgacctgacg
ctttcgggcaatacgatacgaaattacatccgctcgcataatgctccattattcgaactt
ttaactaaacagagcaagcgatga

DBGET integrated database retrieval system