KEGG   Melioribacter roseus: MROS_0757Help
Entry
MROS_0757         CDS       T02176                                 

Definition
glycoside hydrolase family 9
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mro  Melioribacter roseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mro00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874075..875757)
Genome map
AA seq 560 aa AA seqDB search
MKKAAFLVLFFISLLTKAGGFSINQAGYLIDAPKYFFINEPADSFYLHDVVDDKLVFKGA
IELKAKNDPATGMDVYKGDFSGFETPGKYYIALANGKKSPQFEISDTVYNNLFNASLKSY
YYQRCGVGLESKYAGEFKYGKCHTKDARFHPLAGEGYKDVTGGWHDAGDYGKYVVNAGVT
VGTLLMAYEFFPAKFLSDSLNIPESGNRIPDILDEALFEIDWMLKMQREDGAVFTKVTKE
KFEDFVMPDKDVEEGRLIYHVSSTATADFAAVLAKASRLIKDYDKDLAKKYLDAATAAWK
FLSDNPGIIPTGGFKNPEGTVTGEYGDRDDSDERAWAAAELFMSTGDKEYLDYFTIYARK
NNFRFKSISWSQLNDLAYFTILANSSKRNIPEDIKDKIKAELLAYSDYLTAKSDRDGYGV
TILPGEYRWGCNSDVLNNALILIIGYEITGDKNFYNLALGQLNYILGANAHKISFVTGIG
ADYVRHPHHRPTASDGIEEPVPGFLSGGPNQNLQDPVLLKLFDKNTPPAMCYADDTGSWS
SNEIAINWNAPLVFVSGYFK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggctgcgtttttagtcttgttttttatttccttactaacaaaagccggcggt
ttttcgattaatcaggcgggatatttaatcgatgcgccgaagtatttttttataaacgag
ccggcggattcgttctacctgcatgacgttgtagacgacaagttagtatttaaaggcgca
attgaattaaaagccaaaaacgatcccgccaccggaatggatgtttataaaggagatttt
tcaggttttgaaacgccgggtaaatattatattgcgcttgccaacgggaaaaaatcgccg
cagttcgaaatatctgataccgtttataataatttattcaacgcgtctttaaaatcgtat
tattatcaaagatgcggagtcggactcgaaagtaaatatgcgggagaatttaaatacggt
aaatgccatacaaaagacgcgcggtttcatccacttgcgggagaaggctacaaagacgtt
acaggaggctggcacgatgctggcgattacggtaagtatgtagttaacgcgggcgttacc
gtaggaacattgttgatggcatacgaatttttccccgctaaatttttgagcgacagcttg
aatattcccgaaagcggaaaccgtattcccgatattctcgacgaagctttattcgaaatc
gattggatgctgaaaatgcagagggaggacggcgctgtattcacaaaagttactaaagaa
aaattcgaagactttgtaatgccggataaagacgttgaagaaggacgtttgatctatcac
gtttcttcgaccgcgacggcagactttgcggctgttttggctaaagcgtcccgtttgata
aaagactacgataaagacctcgctaaaaagtatctcgatgcggctaccgcggcatggaaa
tttttatctgataatcccggaataataccgacgggaggctttaaaaatcccgaaggcacg
gttacgggcgaatacggcgatcgggacgattccgacgaaagagcctgggctgcggcggaa
ttatttatgtccacaggcgacaaggaatatctcgattattttacaatatatgcgcgcaaa
aataatttccgttttaaatcgatcagctggtcgcaactcaacgacctggcgtactttacc
attctcgccaatagttccaaaagaaatattccggaagatattaaagataaaatcaaagcg
gaattgcttgcttattcggattaccttaccgcaaaaagcgacagagacggctacggggtt
actattctgccgggagaatatcgttggggttgcaactcggacgtcctgaacaatgcgcta
attttaattataggctatgaaataaccggcgataagaatttttataatctggcgttagga
caattgaattatattctgggagctaacgcgcataaaatttcgtttgttaccggtatcggc
gccgattacgtccgtcatccgcatcatcgtccgactgcatccgacggcatagaagagcct
gtgccgggattcttgtccggaggtccgaatcaaaaccttcaggatcctgttctgttaaaa
ttattcgacaaaaatactcctcccgcaatgtgttacgcggacgataccggcagctggtcg
tcaaacgaaattgccatcaattggaatgctcctctggtttttgtaagcggctatttcaaa
taa

DBGET integrated database retrieval system