KEGG   Melioribacter roseus: MROS_2028Help
Entry
MROS_2028         CDS       T02176                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mro  Melioribacter roseus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mro00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MROS_2028
   00051 Fructose and mannose metabolism
    MROS_2028
Enzymes [BR:mro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     MROS_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2359704..2361032)
Genome map
AA seq 442 aa AA seqDB search
MDYLIGNKEYFTGIGKIKYEGPDSKNPLAFKWYDENKVVFGKTMKEYFRFSAAYWHTFCS
ELSDPFGRGTRHLPWNDASDPIERAKGKMDAAFEFTTKLGLPFYCFHDFDVVEEGDSIAE
SDKRLQTLVEYAKEKQKASNVKLLWGTANLFSHPRYMNGAATNPDFNVVAYAATQVKRAL
DATIELGGENYVFWGGREGYLTLLNTNMKREKEHMAKFLELARDYARKQGFKGAFLIEPK
PMEPSKHQYDYDVETVIGFLRHYGLDKDFKLNIEVNHATLAGHTFQHEIQCAVDAGLFGS
IDANRGDYQNGWDTDQFPINIYELVEAMLVIAEAGGFGTGGVNFDAKVRRNSTDIEDLFI
AHIAGMDAFARALLVAEKILNESDYKKIRQERYASFDSGDGARFEKGELTLEDLREIAIK
NGEPKLISGKQEYLEQLINMYI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggattatttgatcggcaacaaagaatattttacaggtatcgggaaaattaaatacgaa
ggacccgattccaaaaatccgcttgcattcaagtggtacgacgaaaataaagtcgtattc
ggaaaaacgatgaaagaatattttcgtttttctgcggcttactggcatactttctgttcg
gaattgtcagatccattcggcagaggcacgcgtcatttgccgtggaacgacgcttccgac
ccgatcgagagagccaaaggcaaaatggacgccgctttcgaattcacgaccaaattgggt
ctccccttctattgtttccacgatttcgacgtggttgaagaaggcgattcgattgccgaa
tccgacaagcgtttgcaaacattggtcgaatacgcgaaagaaaagcaaaaagcatcgaac
gttaaacttctctggggcactgcaaatctgttttcgcatccgcgttatatgaacggagcc
gcaaccaatccggatttcaatgtagtcgcttacgcagccacacaggtcaaacgcgcgcta
gacgctactattgaactcggcggcgagaattacgttttctggggcggccgcgaaggttat
ctgacgctgctcaataccaatatgaaacgcgaaaaagaacatatggctaaatttctcgag
ctcgccagagactatgcacgcaaacaaggtttcaaaggcgctttcctgatcgaaccgaag
ccgatggaaccatcgaaacatcaatacgattacgacgtagaaacggttatcggttttctt
agacactacggactcgacaaagatttcaaattgaacatagaagtcaaccacgctacgctt
gcgggacacacattccagcacgaaattcaatgcgccgtcgatgccggactcttcggcagc
atcgatgcaaaccgcggcgattaccagaacggatgggacaccgatcaattcccgattaac
atttacgaattggtcgaagcgatgcttgtaattgcagaagcgggcggattcggaaccggc
ggggttaatttcgacgcaaaagtacgaagaaattcgaccgacatcgaagatttgttcatt
gcgcatattgccggcatggacgcttttgcccgcgctttactggtcgcggaaaaaattctt
aacgaatcggattacaagaaaatcagacaggaacgttacgcttctttcgattctggcgac
ggagcgcgttttgaaaaaggcgagctcactctcgaagatttaagagagattgcaatcaaa
aacggcgaaccgaaattaataagcggaaagcaggaatatctcgaacagttgatcaacatg
tatatttaa

DBGET integrated database retrieval system