KEGG   Melioribacter roseus: MROS_2353Help
Entry
MROS_2353         CDS       T02176                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mro  Melioribacter roseus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mro00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mro00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2770792..2772012
Genome map
AA seq 406 aa AA seqDB search
MKKYLPLLLILLISVTYAQEKYDIIVAADGSGDCKTLTEAIKKLPMFSYRRVIIFIKKGT
YNERIRIERDYVTLIGEDKDETKIVYNLPREEWNKNPDNIGPGVINIYADDVVLKNLTIE
NTQPEIGPHAFAVYGYGTRTIIYNCNLISKGADTVSLWNYKEGMYYHAKCNFTGAVDFVC
PRGWCFIRDSKFYEVKKTAALWHAGAYDKNQKFVIKNSYIDGVEGFQLARHHYEAQFIFL
DCVFSGNLSDSPVYRVTYDDTTRNRIFHWGKRYYFDGCKREGGNYDWMNDNLRQAGYYKE
EITPAWTFDFKWDPESTEGPSVVQKDIVENCLILNFDEPVTVYGTPELTASNGTKFIYVS
GNENSTVKFRTDKRLTKEDCSGLSITNDAEIISSRASVHKRNVRLD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttacctcttttattgatcttattgatttcggttacttacgcgcaggaa
aaatacgatattatagtggcggcggacggctcgggcgactgcaagactttaacggaagca
attaaaaaattgccgatgttcagttacaggcgcgttataatctttattaagaagggcact
tacaacgaaagaattagaatagaaagagattatgtaacattgataggcgaagataaagac
gaaacaaagatagtctataacctgccgagagaagaatggaacaaaaatccggataatatc
gggcccggagtaattaacatctatgccgacgacgtggtgttgaaaaatctgacgatagaa
aacactcagccggaaatcggccctcatgcttttgcggtatacggctacggcacaagaacc
attatttacaactgcaatctcatcagcaaaggcgccgatacggtttctttgtggaattat
aaagaaggtatgtattatcatgcgaaatgtaattttacaggagccgtcgatttcgtatgt
ccgcgcggctggtgttttataagagattctaaattttatgaagttaaaaaaacggctgct
ctgtggcatgccggcgcttacgataaaaatcaaaagttcgtgattaaaaattcatacatc
gacggagttgaaggttttcaactggcgcgccaccactacgaagcgcaatttattttcctc
gactgcgttttttccgggaatctttccgactcgcctgtctatcgcgttacttatgatgac
acaactcgcaacagaatatttcactggggcaaaagatattatttcgacggatgcaaaagg
gaaggcggcaattacgattggatgaatgataatctgcgacaggcgggatattataaagaa
gaaattactcctgcctggactttcgactttaaatgggaccccgaatcaaccgagggtccg
tcggttgtccaaaaggatatagtagaaaattgtctgatcttaaattttgatgaacccgtt
accgtttacggtacgcccgagttgaccgcttccaatggcacaaaatttatttatgtctcc
ggaaatgaaaattcgacggtaaaatttcgaacggataaacgattgactaaagaagattgc
tcgggattgagtataactaacgacgcagaaattataagcagcagggcatcggtgcataag
agaaatgtgcgcctagattaa

DBGET integrated database retrieval system