KEGG   Melioribacter roseus: MROS_2495Help
Entry
MROS_2495         CDS       T02176                                 

Definition
family 10 endo-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mro  Melioribacter roseus
Brite
Enzymes [BR:mro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MROS_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2921060..2922184
Genome map
AA seq 374 aa AA seqDB search
MKLLTASILFSLLFTAFPAELNSQTLKDAFKDYFLIGCAISDFQAAGKEPKALEIAAEQF
NTITPENMLKWERVHPEPDRFDFELPDRLVEFGQKNGMFIVGHTLVWHNQTPDWVFKDDN
GNYLNREQLLARLKEHIYTVVGRYKGKIKGWDVVNEAVDEDGSLRKTKWLEIIGEDYIEK
AFEFAREADPDAELYYNDFNTWHKAKREGIMRLIKNLLDKGIKIDGIGLQGHWGLDYPAL
DELDESLKEYSSTGLKIMITELDINILPTPNNYTGAEITTNFELQKKYNPYPDGLPDSMQ
TVLAERYAELFGKFLKYRDSISRVTFWGIHDGHSWLNNWPIRGRTSYPLLFDRELKPKPA
FNAVIKTVNEIKCN
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaagttattgacagcttcaattctattttctttattattcacagcatttcccgccgaa
ttgaattcccagacgcttaaagacgcattcaaagattatttcctgatcggatgcgctatc
agcgatttccaggcggcagggaaagagccgaaagctttggaaattgcggccgaacagttt
aatacaataacgccggaaaatatgctcaagtgggaaagagttcatcccgagcccgataga
tttgattttgaacttcccgacagattggtggagttcggtcaaaaaaacgggatgttcatt
gtcggacacacgctcgtctggcacaaccaaactccggattgggtttttaaggacgacaat
ggaaactacctcaatagagaacaactgcttgcaagattgaaagaacatatatatacggta
gtcggcagatacaaaggaaaaattaaaggatgggacgttgtaaacgaagccgtcgacgaa
gacggttctttgcgcaaaaccaaatggctcgaaattataggagaagattatatcgaaaaa
gcttttgaatttgcgcgcgaagccgaccccgacgcggagctctattataacgacttcaat
acctggcataaagccaaaagagaaggcataatgaggttaatcaaaaatttgctcgacaag
gggataaagattgacggcatcggtctccaggggcattggggattggattatccggcattg
gacgaactcgacgaaagcctgaaagaatattcttcgaccggtttgaaaataatgattacc
gaactcgacatcaacattcttccgacgccaaacaactatactggagccgaaattactaca
aattttgaattacaaaaaaaatacaatccctatcccgacggacttccggattcaatgcaa
acggtattagccgaaagatatgcggaattattcggaaaattcctcaaatatcgcgattcg
atctcccgtgtaacattctggggaattcacgacgggcattcatggcttaacaactggcca
atcaggggaagaacttcctatcctcttttattcgacagggaacttaaacccaaaccggct
tttaatgcagtaatcaaaaccgttaacgaaattaaatgcaattga

DBGET integrated database retrieval system