KEGG   Muricauda ruestringensis: Murru_0331Help
Entry
Murru_0331        CDS       T01598                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mrs  Muricauda ruestringensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Murru_0331
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Murru_0331
Enzymes [BR:mrs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Murru_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339391..340968
Genome map
AA seq 525 aa AA seqDB search
MIYRSILLFVAVICMAACQTEKKEINFPKTDLAKAPLIPKPIKTIPTGSAFGLDASTAIY
TSTTNPEFEKVGKLLSENIKTKTGLDVAVNASTGEKLERLIYINQSDSIDLESPESYQLY
IKKDSILLNAKTAAGAFRGVQTLRQLIPEKSNDTLTDHPLWPIPSGKIMDAPKFGYRGSM
LDVARHFFTVEEVKKYIDALAYYKFNTLHLHLSDDQGWRIEIKSWPKLTEVGGVSEVGGG
EGGFYTQEQYKDLLAYAAERHITIVPEIDMPGHTNAASLSYPFLHYAGAETPRVRTDMKV
GYSSFDAKKDTVYSFLDDVIGEIAAMTPGPYFHIGGDESHVTKKDDYILFVEKVEKIVQK
HNKRMIGWDEIAQADIAPSSVVQLWNNAENALNAAENGSKIIISPAKKAYLDMKYDSISE
YGLHWAGYIPVDVGYKWNPETYADGLAKENILGIEAPLWSETISNGTELEYLAFPRIIGY
AELGWSPSEHLNWDDYKERLAAQVPYLKAMQINYYPSKLVDWKKE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgatttacagatcaattttgctgttcgttgcagttatctgcatggcagcttgccaaacc
gaaaaaaaggaaatcaattttccaaaaacagaccttgccaaagctccgttgattccaaaa
cccattaaaaccatcccaacaggtagcgcctttgggctggatgcgagcactgctatttac
acctcgaccacaaacccagagtttgagaaagtgggtaaattgctatccgaaaacataaag
acaaagactggtctggatgttgcggtaaatgcttcaaccggggaaaaattagagcgattg
atctacattaaccaatcggacagcattgatttggagagcccggaatcctatcagctctac
atcaaaaaagattcgattttattgaatgccaaaaccgctgctggggcttttaggggtgta
cagacgcttcgccaactcattccagaaaaaagcaatgatacgcttacggaccatccttta
tggcccatcccatccggaaagataatggatgccccaaaatttgggtaccgtggttccatg
ctggatgttgccagacactttttcacggttgaggaagtcaaaaaatacattgatgccttg
gcgtactacaaatttaacacgctgcatttgcatttgtcggatgatcaagggtggcggatt
gagataaaatcttggcctaaactgaccgaggtaggcggtgtcagtgaagttggtggcggc
gaaggtggattttatacccaagaacagtacaaggatttgcttgcttatgccgcagagagg
catattaccattgtacctgaaattgatatgccgggccataccaatgcagcatccttgagt
tatccttttttacactatgctggagcagagacgcctcgggtacgaaccgacatgaaagta
ggctacagctcttttgatgccaaaaaagacacagtttacagctttttggatgatgttatc
ggcgaaattgctgcaatgactcctggcccatactttcatattggaggtgatgaaagccac
gtgaccaaaaaggatgattacattctttttgtggaaaaagtggaaaaaattgtacaaaag
cacaacaaaagaatgatcggttgggacgaaattgcacaggcagatattgcccctagctcg
gtagttcaattatggaacaatgctgaaaatgccttgaacgcagctgaaaatggttctaaa
attattatttcccctgcaaaaaaggcctatttggacatgaaatacgattccatctccgaa
tacggattgcactgggcaggttacattcctgttgatgttgggtacaaatggaatcccgaa
acttatgcggatgggcttgccaaagaaaatattctcgggattgaagctccgctgtggtcg
gaaaccatcagcaacggtaccgaattggaatatctggccttcccacgaataattggttat
gccgaattgggatggtccccgagcgaacatttaaattgggatgactacaaagagcgcctt
gccgcacaagttccatacctgaaagccatgcagatcaattactacccatcaaaattggtg
gattggaaaaaagaatag

DBGET integrated database retrieval system