KEGG   Muricauda ruestringensis: Murru_0331Help
Entry
Murru_0331        CDS       T01598                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mrs  Muricauda ruestringensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mrs00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mrs00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339391..340968
Genome map
AA seq 525 aa AA seqDB search
MIYRSILLFVAVICMAACQTEKKEINFPKTDLAKAPLIPKPIKTIPTGSAFGLDASTAIY
TSTTNPEFEKVGKLLSENIKTKTGLDVAVNASTGEKLERLIYINQSDSIDLESPESYQLY
IKKDSILLNAKTAAGAFRGVQTLRQLIPEKSNDTLTDHPLWPIPSGKIMDAPKFGYRGSM
LDVARHFFTVEEVKKYIDALAYYKFNTLHLHLSDDQGWRIEIKSWPKLTEVGGVSEVGGG
EGGFYTQEQYKDLLAYAAERHITIVPEIDMPGHTNAASLSYPFLHYAGAETPRVRTDMKV
GYSSFDAKKDTVYSFLDDVIGEIAAMTPGPYFHIGGDESHVTKKDDYILFVEKVEKIVQK
HNKRMIGWDEIAQADIAPSSVVQLWNNAENALNAAENGSKIIISPAKKAYLDMKYDSISE
YGLHWAGYIPVDVGYKWNPETYADGLAKENILGIEAPLWSETISNGTELEYLAFPRIIGY
AELGWSPSEHLNWDDYKERLAAQVPYLKAMQINYYPSKLVDWKKE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgatttacagatcaattttgctgttcgttgcagttatctgcatggcagcttgccaaacc
gaaaaaaaggaaatcaattttccaaaaacagaccttgccaaagctccgttgattccaaaa
cccattaaaaccatcccaacaggtagcgcctttgggctggatgcgagcactgctatttac
acctcgaccacaaacccagagtttgagaaagtgggtaaattgctatccgaaaacataaag
acaaagactggtctggatgttgcggtaaatgcttcaaccggggaaaaattagagcgattg
atctacattaaccaatcggacagcattgatttggagagcccggaatcctatcagctctac
atcaaaaaagattcgattttattgaatgccaaaaccgctgctggggcttttaggggtgta
cagacgcttcgccaactcattccagaaaaaagcaatgatacgcttacggaccatccttta
tggcccatcccatccggaaagataatggatgccccaaaatttgggtaccgtggttccatg
ctggatgttgccagacactttttcacggttgaggaagtcaaaaaatacattgatgccttg
gcgtactacaaatttaacacgctgcatttgcatttgtcggatgatcaagggtggcggatt
gagataaaatcttggcctaaactgaccgaggtaggcggtgtcagtgaagttggtggcggc
gaaggtggattttatacccaagaacagtacaaggatttgcttgcttatgccgcagagagg
catattaccattgtacctgaaattgatatgccgggccataccaatgcagcatccttgagt
tatccttttttacactatgctggagcagagacgcctcgggtacgaaccgacatgaaagta
ggctacagctcttttgatgccaaaaaagacacagtttacagctttttggatgatgttatc
ggcgaaattgctgcaatgactcctggcccatactttcatattggaggtgatgaaagccac
gtgaccaaaaaggatgattacattctttttgtggaaaaagtggaaaaaattgtacaaaag
cacaacaaaagaatgatcggttgggacgaaattgcacaggcagatattgcccctagctcg
gtagttcaattatggaacaatgctgaaaatgccttgaacgcagctgaaaatggttctaaa
attattatttcccctgcaaaaaaggcctatttggacatgaaatacgattccatctccgaa
tacggattgcactgggcaggttacattcctgttgatgttgggtacaaatggaatcccgaa
acttatgcggatgggcttgccaaagaaaatattctcgggattgaagctccgctgtggtcg
gaaaccatcagcaacggtaccgaattggaatatctggccttcccacgaataattggttat
gccgaattgggatggtccccgagcgaacatttaaattgggatgactacaaagagcgcctt
gccgcacaagttccatacctgaaagccatgcagatcaattactacccatcaaaattggtg
gattggaaaaaagaatag

DBGET integrated database retrieval system