KEGG   Muricauda ruestringensis: Murru_0353Help
Entry
Murru_0353        CDS       T01598                                 

Definition
succinyl-CoA ligase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mrs  Muricauda ruestringensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Murru_0353
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Murru_0353
   00640 Propanoate metabolism
    Murru_0353
   00660 C5-Branched dibasic acid metabolism
    Murru_0353
Enzymes [BR:mrs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Murru_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(359785..360978)
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILASFGVRIQRGIVAHNPKEAVDAAKQLTQETGTGWHVIKAQVHAGGRGK
GGGVKLAKNLKEVEEIAGNIIGMNLVTPQTSAEGKKVHQVLVAEDVYYPGDSETSEFYMS
VLLNRGTGRNMIMYSTEGGMDIEEVAENTPHLIFTEEVDPGLGLLPFQARRIAFNLGLSG
TAFKEMVKFVMSLYKAYVESDSSLFEINPVLKTSDDKIMAVDAKVSIDDNALYRRKAYAE
MRDLREENPIEVEAREVGLNYVDLDGNVGCMVNGAGLAMATMDLIKMAGGEPANFLDVGG
TADAKRVEEAFRIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAIQVPIIVRL
QGTNAELAKEIIDNSGLAVHSAVQFKEAADKVEEVLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgaatatcaaggaaaagagattttagccagttttggagttagaatccaa
cgaggaattgttgcccacaaccctaaagaagcggtagatgccgcaaaacaacttacacaa
gaaaccggaaccggatggcacgtaataaaagcacaagtgcatgccggtggccgtggtaag
ggcggtggcgtaaaattggccaaaaacttgaaagaagtagaagagatagctggtaacatc
ataggtatgaaccttgttaccccgcaaacatctgccgaaggtaaaaaagtacatcaggta
ttggtagctgaagatgtgtactacccaggtgacagtgagaccagcgagttttacatgtcg
gttcttttgaacaggggaaccggaagaaacatgatcatgtattctaccgaaggtggtatg
gatattgaagaagtggcggagaatacccctcatttgatctttaccgaagaagtagaccct
ggattaggtctattaccttttcaagcaagaaggattgcctttaacttgggtctctccggt
actgcgttcaaagaaatggtaaagttcgtaatgtctttgtacaaagcttacgttgaaagc
gattccagtctttttgaaatcaatccggtcttgaagacttcagatgataaaattatggca
gttgatgccaaagtatctattgacgacaacgcattatatagaagaaaagcgtatgctgaa
atgcgtgaccttcgcgaagaaaacccgatcgaggttgaagcgcgtgaagtaggtttgaac
tatgttgatttggacggcaacgtaggttgtatggttaacggcgccggattggcaatggct
accatggacttgattaaaatggccggtggagaaccagcaaacttcttggatgtaggtggt
actgcagacgccaaaagggtagaagaagcttttcgaattatcctaaaagaccctaacgta
aaagcaatccttatcaatatttttggaggtattgttcgttgcgaccgtgtggcacaaggt
gttgtagatgcctataaaaatatgggagatgcaatacaagtaccgattattgtcaggcta
cagggtacaaatgccgaattggccaaggaaatcatcgacaactccgggttggcagtacat
tctgccgtacagtttaaagaagctgcagataaagtagaagaggttttgagctag

DBGET integrated database retrieval system