KEGG   Muricauda ruestringensis: Murru_0997Help
Entry
Murru_0997        CDS       T01598                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mrs  Muricauda ruestringensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Murru_0997
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Murru_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1100872..1101615
Genome map
AA seq 247 aa AA seqDB search
MKVKTILVSQPEPKVENSPYSRLIEKEKVKVDFRPFIHVEGVEAKNVRQQKIDLNNFTAI
ILTSRNSVDHFFRIADEMRFKVPDSMKYFCQSEAVAYYLQKYVVYRKRKIYVGKRTFNEL
TPLIKKYKDEKFLLPSSDSLKPSVPELLDEVGVNWTRGIFYKTVISDLSDLRNVYYDILV
FFSPSGIESLMKNFPDFEQNDTRIAVFGNSTVKAATTAGLRIDIQAPTPETPSMTMALQK
YITSVNK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaacaattttggtttcccaaccagaacccaaagtcgaaaactccccctat
tcgcgattaattgaaaaggagaaggttaaagtagattttagacctttcatacatgttgaa
ggtgtagaagccaaaaatgtgagacagcagaaaatcgacttgaacaattttacggcgatt
atcctgacgagcagaaactctgtggatcactttttcagaattgccgatgaaatgcgcttc
aaagttccagattccatgaaatatttttgtcagtcagaggcagtagcctactatttgcaa
aaatatgtggtgtacagaaaaaggaagatctatgttgggaagagaacttttaacgagttg
actcccttgatcaagaaatacaaggacgaaaagttcctgttaccatcttccgattcccta
aaacccagtgttcctgagctattggacgaggttggcgtgaattggactcgtggcatcttc
tacaaaacggtaataagcgacctttcggatctaaggaatgtatactatgacattttggtt
ttctttagcccttcaggtattgaatccttgatgaagaacttcccggattttgaacaaaac
gatactaggattgccgtttttggcaacagtacggttaaagcagctacaacggctgggcta
cgaatagatattcaggcaccgacgcccgaaactccatccatgaccatggctttacagaaa
tacattaccagcgttaataaataa

DBGET integrated database retrieval system