KEGG   Muricauda ruestringensis: Murru_1357Help
Entry
Murru_1357        CDS       T01598                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mrs  Muricauda ruestringensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Murru_1357
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Murru_1357
Enzymes [BR:mrs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Murru_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1486660..1487208
Genome map
AA seq 182 aa AA seqDB search
MIKATETKLKGCFIIEPTVFEDERGYFFESYNHKDFCEAIGREVNFVQDNQSFSTKGVLR
GLHFQRGEHAQAKLIQVLEGAIQDVVVDFRKDSPTFARHFSMELSDKNKKQLFVPRGFAH
GFLTLSDTAKVMYKCDNYYNHKAEGGLRFDCPELKIKWLIGADDLLLSEKDRKLPNYLSA
LT
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggcaacggagaccaagttaaaagggtgctttataattgagcccacagttttt
gaagatgagcggggctatttttttgaaagttacaaccacaaggatttttgtgaagcaatc
ggacgagaagtaaactttgtgcaggataaccaatccttttccacaaaaggagtactccgg
gggttgcattttcagaggggggaacacgcccaagctaagctaatacaggttcttgaaggg
gcaatccaagatgttgtagttgactttcgtaaagattctcctacctttgcgcggcatttc
tccatggagctgagcgacaagaacaaaaaacagttatttgtgcctagaggtttcgcccat
gggtttttaacgttgagcgatacggcaaaagtaatgtacaagtgcgataattactataac
cacaaagcggagggaggacttcgttttgattgtcctgaactgaaaataaagtggttaatc
ggcgctgatgatttgctactctctgaaaaagataggaaattgccaaactatttgagcgca
ctaacataa

DBGET integrated database retrieval system