KEGG   Muricauda ruestringensis: Murru_1482Help
Entry
Murru_1482        CDS       T01598                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mrs  Muricauda ruestringensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Murru_1482
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Murru_1482
Exosome [BR:mrs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Murru_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1613304..1614293)
Genome map
AA seq 329 aa AA seqDB search
MYPLIRNRRLRASESIRRLVRETTLTPDDFLVPLFVTEGKGIREEIPSMPNYFRLSLDNL
EKEVKELWKMGLCSVLLFVKVDDKLKDNKGTEALNPNGLMQRAIKTVKNACPQMLVMTDV
ALDPFSSYGHDGIVAEGQILNDETTEVLAEMSVSHAKAGADFVAPSDMMDGRILTIREAL
EDEGFTNTGIMAYSAKYASAFYGPFRDALDSAPVDIANVPKDKKTYQMDYANRYEAIKET
QMDIDEGADIVMVKPGLCYLDIVREIRNDVDVPVAVYQVSGEYAMVKAAAEKGWLDHDAV
MLEQLTAIKRAGANIIASYFAKDFIRIFH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtacccactcatacgaaacagaagactacgcgcatccgaatccattagaagattggtt
cgggaaaccaccttgacgccagacgactttctggtgcctttatttgtgacagaaggaaaa
ggaattagggaagaaataccttccatgcccaactattttaggttgagtttggacaatctt
gaaaaagaagtgaaggaactctggaaaatgggactttgttccgtgcttctttttgtaaag
gttgatgataaacttaaagataacaaaggaaccgaggccttaaatccgaacggtttgatg
caacgtgccataaaaacagtaaaaaacgcctgtccacaaatgttggtgatgacggacgtt
gccctggacccattttcctcttatggacacgatggcattgttgccgaaggtcaaatcttg
aacgatgaaactacagaggttttggcagaaatgagcgtctcccatgccaaagctggggcc
gactttgtagcccccagcgatatgatggacggtagaattttgaccatccgagaggctttg
gaggatgaaggattcaccaatacgggcattatggcctattctgccaaatacgccagcgca
ttttacggaccgttccgcgatgccttggattccgcacccgtggatattgccaatgtgccc
aaggacaaaaagacctatcaaatggattatgccaatcggtatgaagccatcaaagaaacc
caaatggacattgacgaaggagccgatattgtaatggtaaaacctggattgtgctatttg
gacatcgttcgggaaatccgaaacgatgtagatgtcccggttgccgtttatcaagtttcc
ggagagtatgccatggtaaaagccgctgccgaaaaagggtggttggatcacgatgccgtg
atgttggaacagcttacggccattaaaagagccggtgccaatattatcgccagttacttt
gcgaaggattttatcagaatatttcactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system