KEGG   Muricauda ruestringensis: Murru_1530Help
Entry
Murru_1530        CDS       T01598                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mrs  Muricauda ruestringensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mrs00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1659285..1659881
Genome map
AA seq 198 aa AA seqDB search
MTEGGKLIIFSAPSGSGKTTIVKHLLDQLELNLAFSISATSRPRRGKEKNGVNYYFMSVS
QFKRHIKDGDFLEWEEVYRDNFYGTLKSEVERLWAEGKNVIFDIDVSGGLRIKKKFPEKT
LAVFVKPPSVDELKIRLKKRSTESDDKINMRIAKASVELATAPQFDKIIKNYDLDVALNE
AHRLVAEFVGAEMPPKED
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaggcggtaaacttatcattttctcggcaccctcaggcagtggtaaaaccacg
attgtgaagcatctattggatcaactagaactgaacttggcattttccatatcggcaaca
tcccgccctcgaaggggaaaggaaaagaatggggtcaactactattttatgtcggtttcc
caatttaaaaggcacatcaaagacggtgattttttggaatgggaagaagtgtaccgggat
aatttttatggtactcttaaaagtgaagtagagcgtctttgggccgaagggaaaaacgtg
atttttgatattgatgtttctggcggacttagaattaaaaagaagtttccggagaaaaca
ttggccgtttttgtaaaacctcccagtgttgatgaacttaaaatcagactgaaaaaaaga
agtaccgaaagcgatgataaaatcaatatgcggattgccaaggcatccgtggagctggcc
acagcccctcagtttgataaaatcatcaagaactacgacctcgatgttgctcttaatgag
gcccatagattggtcgccgaatttgttggggccgagatgccccctaaagaagattag

DBGET integrated database retrieval system