KEGG   Muricauda ruestringensis: Murru_1530Help
Entry
Murru_1530        CDS       T01598                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00230  Purine metabolism
mrs01100  Metabolic pathways
Module
mrs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Murru_1530
Enzymes [BR:mrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Murru_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 Herpes_BLRF2 AAA NTPase_1 CPT cobW RsgA_GTPase TsaE AAA_19 MobB RNA_helicase AAA_30 ABC_tran T2SSE
Motif
Other DBs
NCBI-ProteinID: AEM70571
UniProt: G2PQH6
Position
1659285..1659881
Genome map
AA seq 198 aa AA seqDB search
MTEGGKLIIFSAPSGSGKTTIVKHLLDQLELNLAFSISATSRPRRGKEKNGVNYYFMSVS
QFKRHIKDGDFLEWEEVYRDNFYGTLKSEVERLWAEGKNVIFDIDVSGGLRIKKKFPEKT
LAVFVKPPSVDELKIRLKKRSTESDDKINMRIAKASVELATAPQFDKIIKNYDLDVALNE
AHRLVAEFVGAEMPPKED
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaggcggtaaacttatcattttctcggcaccctcaggcagtggtaaaaccacg
attgtgaagcatctattggatcaactagaactgaacttggcattttccatatcggcaaca
tcccgccctcgaaggggaaaggaaaagaatggggtcaactactattttatgtcggtttcc
caatttaaaaggcacatcaaagacggtgattttttggaatgggaagaagtgtaccgggat
aatttttatggtactcttaaaagtgaagtagagcgtctttgggccgaagggaaaaacgtg
atttttgatattgatgtttctggcggacttagaattaaaaagaagtttccggagaaaaca
ttggccgtttttgtaaaacctcccagtgttgatgaacttaaaatcagactgaaaaaaaga
agtaccgaaagcgatgataaaatcaatatgcggattgccaaggcatccgtggagctggcc
acagcccctcagtttgataaaatcatcaagaactacgacctcgatgttgctcttaatgag
gcccatagattggtcgccgaatttgttggggccgagatgccccctaaagaagattag

DBGET integrated database retrieval system