KEGG   Muricauda ruestringensis: Murru_1606Help
Entry
Murru_1606        CDS       T01598                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mrs  Muricauda ruestringensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Murru_1606
   00051 Fructose and mannose metabolism
    Murru_1606
Enzymes [BR:mrs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Murru_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1739104..1740429
Genome map
AA seq 441 aa AA seqDB search
MITKGDKEFFKGIGKIPFEGKESDNPLAFKYYDENKMVGGKTMKEHFKFAIAYWHTFNDT
GSDPFGAPTKNFPWLINTDPVQQAKDKMDAAFEFITKIGAPYYCFHDIDLIDEGSTLAES
EKRLDIITDYAQEKMKESGVKLLWGTANCFSHPRYMNGAATNPDFDVVATAGAQVKNALD
ATIKLGGENYVFWGGREGYMSLLNTDMGREQDHMARFLHMAKDYARAQGFKGTFFIEPKP
MEPTKHQYDFDSATVIGFLTKYDLLDDFKLNIEVNHATLAQHTFEHELQVAADNNLLGSI
DANRGDYQNGWDTDQFPVDVYELAQAMLVILQAGGFQGGGINFDAKLRRNSTDLEDIFYA
HIGGMDAFSRALLAANAILENSNYLSLRKNRYASFDTGSGKAFEEGELSLEDLYAHATTH
QDIKKISGKQELFENIINQYI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaaaggagacaaagaattttttaaaggcataggcaaaattcctttcgagggg
aaagaatcggataaccctttggcttttaaatattatgatgaaaataagatggtaggcggc
aaaaccatgaaagaacatttcaaatttgccatcgcctactggcatacttttaacgacacg
ggtagcgacccctttggggcacccaccaaaaatttcccgtggttgatcaatacagaccct
gttcagcaggccaaggacaaaatggatgccgccttcgaattcatcacaaaaattggtgcg
ccctattactgtttccacgatattgacctgattgatgagggcagtaccttggccgaatcg
gaaaaaagattggacatcataacggattatgcccaagaaaagatgaaggaatccggagtt
aaattgctctggggaacggcaaactgtttcagccatccacgctacatgaacggagccgct
accaaccccgattttgacgtggtagccactgcaggagcccaagttaaaaatgcactcgat
gccaccatcaaacttggaggggaaaactatgtgttctggggaggacgcgaagggtacatg
tcattgctcaacaccgatatgggccgcgaacaggaccatatggcacgcttcctgcacatg
gcaaaggattatgcccgtgcgcaagggtttaaaggaacattctttattgagcccaaaccc
atggaacccacaaagcaccaatacgactttgattcggccactgttatcgggttccttacc
aaatacgatttattggacgattttaaactcaatattgaggtaaaccacgcaactctggca
caacatacctttgagcatgaactgcaagtggcagcggacaacaatcttttgggaagcatt
gatgccaataggggcgattaccaaaacggttgggacacagaccagttccctgttgatgtt
tacgagctggcccaagctatgttggtaatcctgcaagcaggtggtttccaaggtggaggc
attaattttgatgccaaactgagaagaaactccaccgatctggaagacattttctatgcg
cacattgggggaatggatgcattttcaagggcattgttggcggccaacgccattttggaa
aattccaattaccttagcttgcgaaaaaatcgctacgcatcttttgataccggttctggg
aaggcattcgaggaaggtgaactttctttggaagacctttatgcacatgctacaacccat
caggacatcaaaaaaatcagcggtaagcaagaattgttcgaaaatattatcaaccagtat
atttga

DBGET integrated database retrieval system